DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptprsa

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_021325154.1 Gene:ptprsa ZFINID:ZDB-GENE-020107-3 Length:1945 Species:Danio rerio

Alignment Length:75 Identity:26/76 (34%)
Similarity:37/76 (49%) Gaps:4/76 (5%)


  Fly    83 RKITFFCMAQGNPRPTITWFKDGAELYQH----RFFQVHESHIEANIVKSKMEIDPTTQMDAGFY 143
            |..|..|.|.|||.|.||||||...:..:    |..|:.....|...::..::|:.|.:.|.|.|
Zfish   148 RTATMLCAASGNPDPEITWFKDFLPIDPNTSNGRIKQLRSEAFEGTPIRGALQIENTEETDQGKY 212

  Fly   144 ECQADNIYAI 153
            ||.|.|:..:
Zfish   213 ECVASNVEGV 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 25/74 (34%)
ptprsaXP_021325154.1 I-set 31..122 CDD:254352
Ig2_RPTP_IIa_LAR_like 150..233 CDD:319301 25/74 (34%)
Ig3_RPTP_IIa_LAR_like 257..325 CDD:143216
FN3 330..419 CDD:238020
FN3 426..518 CDD:238020
FN3 523..612 CDD:238020
FN3 620..713 CDD:238020
fn3 721..819 CDD:306538
FN3 831..919 CDD:238020
fn3 931..1015 CDD:306538
FN3 1028..1101 CDD:238020
PTPc 1415..1644 CDD:238006
PTPc 1676..1935 CDD:214550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.