DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptprda

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_003199071.4 Gene:ptprda ZFINID:ZDB-GENE-101103-16 Length:372 Species:Danio rerio

Alignment Length:115 Identity:30/116 (26%)
Similarity:46/116 (40%) Gaps:26/116 (22%)


  Fly    20 IFGDLIYIAAQRSTAGKTERRNYTGKKPVVIQHRSQDAVNYYDHENGAKIIKSSHFELDYTLGRK 84
            |:|.:..:.|||:...:||      .:.|.|....|:|||....|..|:.:        |...:|
Zfish    41 IYGHVTLMRAQRNYMVQTE------DQYVFIHDSLQEAVNCGTTEVPARNL--------YAYIQK 91

  Fly    85 ITFFCMAQGNPRPTITWFKDGAELYQHRF--FQVHESH-IEANIVKSKME 131
            :|     |......:|    |.||...|.  .:.|.|. |.||:..:|.:
Zfish    92 LT-----QIESGENVT----GMELEFKRLANTKAHTSRFISANLPCNKFK 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 13/51 (25%)
ptprdaXP_003199071.4 PTPc <14..71 CDD:328744 10/36 (28%)
PTPc 103..362 CDD:214550 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.