powered by:
Protein Alignment CG7607 and ptprd
DIOPT Version :9
| Sequence 1: | NP_648449.1 |
Gene: | CG7607 / 39263 |
FlyBaseID: | FBgn0036145 |
Length: | 167 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_017209878.1 |
Gene: | ptprd / 100330629 |
-ID: | - |
Length: | 1944 |
Species: | Danio rerio |
| Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
| Similarity: | 33/70 - (47%) |
Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 83 RKITFFCMAQGNPRPTITWFKDGAEL---YQHRFFQVHESHIEANIVKSKMEIDPTTQMDAGFYE 144
|..|..|.|.|||.|.|:||||...: ...|..|:.........::..::|:.:.:.|.|.||
Zfish 150 RTATMLCAASGNPDPDISWFKDFLPVNTSNNGRIKQLRSESFGGTPIRGALQIEQSEESDQGKYE 214
Fly 145 CQADN 149
|.|.|
Zfish 215 CVATN 219
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.