DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptprdb

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_021330723.1 Gene:ptprdb ZFINID:ZDB-GENE-070615-38 Length:1955 Species:Danio rerio

Alignment Length:85 Identity:27/86 (31%)
Similarity:38/86 (44%) Gaps:12/86 (14%)


  Fly    68 KIIKSSHFELDYTLGRKITFFCMAQGNPRPTITWFKDGAELYQH---RFFQVHESHIEANIVKSK 129
            |:::.|         |..|..|.|.|.|.|.||||||...:..|   |..|:.........::..
Zfish   143 KVVERS---------RTATMLCAASGTPDPEITWFKDFLPIDTHTHGRIKQLRSESFGGTPIRGA 198

  Fly   130 MEIDPTTQMDAGFYECQADN 149
            ::||.:.:.|.|.|||.|.|
Zfish   199 LQIDQSEETDQGKYECVATN 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 24/69 (35%)
ptprdbXP_021330723.1 I-set 32..123 CDD:254352
Ig2_RPTP_IIa_LAR_like 151..233 CDD:319301 24/69 (35%)
Ig3_RPTP_IIa_LAR_like 257..325 CDD:143216
FN3 330..419 CDD:238020
FN3 426..517 CDD:238020
FN3 523..613 CDD:238020
fn3 620..707 CDD:306538
FN3 722..827 CDD:238020
FN3 829..920 CDD:238020
FN3 957..1043 CDD:238020
PTPc 1417..1654 CDD:238006
PTPc 1686..1945 CDD:214550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.