DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7607 and ptprs

Sequence 1:NP_648449.1 Gene:CG7607 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001135464.1 Gene:ptprs XenbaseID:XB-GENE-478236 Length:661 Species:Xenopus tropicalis

Alignment Length:70 Identity:25/71 (35%)
Similarity:33/71 (46%) Gaps:11/71 (15%)


  Fly    83 RKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHESHIEANIVKSK---MEIDPTTQMDAGFYE 144
            |..|..|.|.|||.|.||||||        |..|..:.....|.:.:   ::|:.:.:.|.|.||
 Frog   141 RTATMLCAASGNPDPEITWFKD--------FLPVDPASSNGRIKQLRSGALQIENSEETDQGKYE 197

  Fly   145 CQADN 149
            |.|.|
 Frog   198 CVATN 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7607NP_648449.1 Ig 85..159 CDD:143165 24/69 (35%)
ptprsNP_001135464.1 I-set 24..115 CDD:254352
Ig 41..112 CDD:143165
IG_like 132..216 CDD:214653 25/71 (35%)
Ig2_RPTP_IIa_LAR_like 143..217 CDD:143215 24/69 (35%)
IG_like 229..306 CDD:214653
Ig3_RPTP_IIa_LAR_like 237..305 CDD:143216
FN3 310..399 CDD:238020
FN3 406..498 CDD:238020
FN3 503..591 CDD:238020
fn3 599..>661 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000235
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.