DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14142 and mindy4

Sequence 1:NP_648447.2 Gene:CG14142 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001072940.1 Gene:mindy4 XenbaseID:XB-GENE-6456867 Length:746 Species:Xenopus tropicalis

Alignment Length:431 Identity:115/432 (27%)
Similarity:176/432 (41%) Gaps:93/432 (22%)


  Fly    10 GTPITAELATDLRNLVFGTAAIPMRAEWLQTSFVFGAPKEELAYGLRSPRNATRGLLSVVQGFVL 74
            |.||....|.:::.::||::......||...||.|. ..:.|.||....:....|:|:.|||.||
 Frog   396 GKPIDLAQAVEIKKILFGSSFCCFSDEWKIQSFTFN-NNQPLRYGFIQKKGGPCGVLAAVQGCVL 459

  Fly    75 KYLLFARKTSRVASLTDPLLATADMQREALFC-ALLEILRTISDKGKVTMVLPSEDEVFVDHSAC 138
            |.|||.:.    |.|.  :|..:|.||.:..| |:.:||....|..:..:.|......| ..:..
 Frog   460 KNLLFGKD----ADLR--VLQPSDSQRTSCLCKAIADILWRAGDNKEAVVALSCGRPQF-SPAGR 517

  Fly   139 YFHDSVTEKLYVFTLSPNDELEYFLKRNFKYFTEEETP-GTLLFLYSAVLTRSMGKVRTDLDSAK 202
            |..|.:.|.|.::.:...::|..|::::...|  |..| |..|...|.||:||:..|:.|.|  .
 Frog   518 YKADGILESLILYKIRKYEDLMGFVQQHISQF--ELGPFGCTLLTLSVVLSRSVELVQKDFD--V 578

  Fly   203 STPLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAVPQYGVLKRCMIGLL-LWDIES 266
            ||......|...:..:|.|:|:|||...:.|.||.:...:.......||..|..||.| |::..:
 Frog   579 STNCLIGAHSYCTQELVNLILSGRAVSNVFNDVVELDSGNGNITLLRGVAHRTDIGFLSLFEHYN 643

  Fly   267 ASAAVNQSRQPGSRLKTPNYPIWITSCTGHFGVIFNKNPDLLRNYHAESRFDVNYYSCSGHQ--- 328
            ..       |.||.||||.:|||:.....||.|:|....:|:.::..|.|||:.||....:|   
 Frog   644 VC-------QVGSYLKTPRFPIWVICSESHFSVLFCVRRELMSDWKMERRFDLYYYDGLANQQDE 701

  Fly   329 ILMTIDN-RTYNEQALVMLERQPITPESTSMSGKEDGGGATSPTTVSGGGGAAAGGGVGGASGGV 392
            |.:|:|. .||.|:                                                   
 Frog   702 IRLTVDTAATYIEE--------------------------------------------------- 715

  Fly   393 GGAASGASGGNDVVAKEESTLNTPLQRLIRTKWEEATISFH 433
                            :|:.|..||:..|||||:.|.|.::
 Frog   716 ----------------QENDLTPPLEHCIRTKWKGAVIDWN 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 111/418 (27%)
mindy4NP_001072940.1 DUF4205 408..741 CDD:290609 111/420 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334491325
eggNOG 1 0.900 E1_KOG2871
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I3872
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1276386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T601917
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2356
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.