DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14142 and mindy3

Sequence 1:NP_648447.2 Gene:CG14142 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001071224.1 Gene:mindy3 ZFINID:ZDB-GENE-061110-13 Length:446 Species:Danio rerio

Alignment Length:511 Identity:99/512 (19%)
Similarity:166/512 (32%) Gaps:172/512 (34%)


  Fly     2 NKEFI-------TQGGTPITAELATDLRNLVFGTAAIPMRAEWLQTSFVFGAPKEELAYGLRSPR 59
            |||.:       :.||.|.:                  :...|.| .|||...:..   .|....
Zfish     5 NKEVVDLVWGRPSGGGVPAS------------------LFRRWSQ-GFVFSETERS---ALEQFE 47

  Fly    60 NATRGLLSVVQGFVLKYLLFARKTSRVASLTDPLLATADMQREALFCALLEILRTISDKGKVTMV 124
            .....:::.||.|:||.:||..:......:::      :.||..|...|.|||.         :.
Zfish    48 GGPCAVIAPVQAFLLKNILFNTEGLNWKDISE------EEQRTVLCSTLSEILE---------LA 97

  Fly   125 LPSEDEVFVDHSACYFHDSVTEKLYVFTLSPNDE-----------------LEYF----LKRNFK 168
            ..::.:.|  |...:.|...|:...:....|..|                 .|.|    .||..:
Zfish    98 CLNKSQAF--HLVTWPHAKTTDNSDITDSHPEPESSQPTDTPTALATEELGFERFHSVIQKRTLR 160

  Fly   169 ------------YFTEEETPGTLLFLYSAVLTRSMGKVRTDLDSAKSTPLTSSNHEEGSLMIVTL 221
                        |.|.:...|.||||||.:||:.:..::.:::.. :.||....:..||..::.|
Zfish   161 TVAELKEAVLSLYDTWKNKFGVLLFLYSVILTKGIENIKNEIEDT-TEPLIDPVYGHGSQSLINL 224

  Fly   222 LLTGRATPYIHNGVVNV--GDESSYAVPQYGVLKRCMIGLLLWDIESASAAVNQSRQPGSRLKTP 284
            |:||.|       |.||  ||.....:..:|:.::..:|.|.. :||....     :.|:.||:|
Zfish   225 LVTGHA-------VSNVWDGDRECSGMKLHGIYQQASVGFLTL-MESLRYC-----KVGAFLKSP 276

  Fly   285 NYPIWITSCTGHFGVIFNKNPDLLRNYHAESRFDVNYYSCSGHQILMTIDNR------------- 336
            .:||||.....|..|.|.|...|:....|..:         ..::..|.|..             
Zfish   277 KFPIWILGSETHLSVFFTKEMALVAPESASEQ---------ARRVFQTFDPEDNGFIPDTLLEDV 332

  Fly   337 -----TYNEQALVMLERQPITPESTSM---------------------------SGKEDGGGATS 369
                 ..:|...|.|.:..:.||...:                           :|.:.......
Zfish   333 MKALDLVSEPDYVNLMKSKLDPEGLGIILLGQFLLEFFPDQDSVIPDSFPVYHYNGLKQSNHNEK 397

  Fly   370 PTTVSGGGGAAAGGGVGGASGGVGGAASGASGGNDVVAKEESTLNTPLQRLIRTKW 425
            .:.|.|                    .:...|..|.:.:   |.:||::|.::|||
Zfish   398 VSYVEG--------------------TALVMGFEDPMVR---TDDTPVKRCLQTKW 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 93/485 (19%)
mindy3NP_001071224.1 DUF4205 29..>299 CDD:290609 72/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2871
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1276386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.