powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG14142 and aqp4
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_648447.2 | 
            Gene: | CG14142 / 39261 | 
            FlyBaseID: | FBgn0036143 | 
            Length: | 447 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_001345242.1 | 
            Gene: | aqp4 / 445293 | 
            ZFINID: | ZDB-GENE-040724-152 | 
            Length: | 346 | 
            Species: | Danio rerio | 
          
        
        
        
          
            | Alignment Length: | 193 | 
            Identity: | 40/193 - (20%) | 
          
          
            | Similarity: | 71/193 -  (36%) | 
            Gaps: | 52/193 - (26%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   206 LTSSNHE--EGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAV-----PQYGVLK---RCMIGLL 260 
            :||.|.|  .|..:::.|::|               .|..:.|     |:...||   ...|||. 
Zfish   149 VTSVNEEISAGHAIVIELIIT---------------FELVFTVFATCDPKRNDLKGSAALAIGLS 198 
 
  Fly   261 -----LWDIESASAAVNQSRQPGSRL----KTPNYPIWITSCTGH------FGVIFNKNPDLLRN 310 
                 |:.|....|::|.:|..|..:    ...::..|:....|.      :..:|..:|||.|. 
Zfish   199 VCIGHLFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRR 263 
 
  Fly   311 YH---AESRFDVNYYSCSGHQILMTIDNRTY-NEQALVMLERQPITPESTSMSGKEDGGGATS 369 
            |.   ::|.|.:..|        ..:|..:| ::||.:|.::..:.........:|..|...| 
Zfish   264 YADVLSKSPFQMEPY--------RVVDTDSYPSDQAQLMAKQAALRVLDLEKKERESTGEVLS 318 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            1 | 
            1.030 | 
            - | 
            avgDist | 
            Average_Evolutionary_Distance | 
            R2356 | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | ZFIN | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 1.030 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.