DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14142 and aqp4

Sequence 1:NP_648447.2 Gene:CG14142 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio

Alignment Length:193 Identity:40/194 (21%)
Similarity:71/194 (37%) Gaps:52/194 (27%)


  Fly   206 LTSSNHE--EGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAV-----PQYGVLK---RCMIGLL 260
            :||.|.|  .|..:::.|::|               .|..:.|     |:...||   ...|||.
Zfish   149 VTSVNEEISAGHAIVIELIIT---------------FELVFTVFATCDPKRNDLKGSAALAIGLS 198

  Fly   261 -----LWDIESASAAVNQSRQPGSRL----KTPNYPIWITSCTGH------FGVIFNKNPDLLRN 310
                 |:.|....|::|.:|..|..:    ...::..|:....|.      :..:|..:|||.|.
Zfish   199 VCIGHLFAIPYTGASMNPARSFGPAVIMVKWQDHWVYWVGPLIGGILAAAVYEYLFCPDPDLKRR 263

  Fly   311 YH---AESRFDVNYYSCSGHQILMTIDNRTY-NEQALVMLERQPITPESTSMSGKEDGGGATS 369
            |.   ::|.|.:..|        ..:|..:| ::||.:|.::..:.........:|..|...|
Zfish   264 YADVLSKSPFQMEPY--------RVVDTDSYPSDQAQLMAKQAALRVLDLEKKERESTGEVLS 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 40/194 (21%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 23/116 (20%)
DUF737 <290..>345 CDD:310129 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2356
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.