DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14142 and aqp3a

Sequence 1:NP_648447.2 Gene:CG14142 FlyBaseID:FBgn0036143 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_998633.1 Gene:aqp3a ZFINID:ZDB-GENE-040426-2826 Length:296 Species:Danio rerio

Alignment Length:191 Identity:45/192 (23%)
Similarity:70/192 (36%) Gaps:57/192 (30%)


  Fly   140 FHDSVTEKLYVFTLSPNDELEYFLKRNFKYFTEEETPGTLLFLYSAVLTRSMGKVRTDLDSAKST 204
            :||::    |.:....|:.|         ...|:||.|......|..||...|.....:.:|   
Zfish   123 YHDAI----YDYAGESNELL---------VLGEKETAGIFATYPSKYLTPLNGFFDQVIGTA--- 171

  Fly   205 PLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAVPQYGVLKRCMIGLLLWDIESASA 269
                      ||::..|.:   ..||  |..:..|.| ::.| .:.||   :|||.:.  .::..
Zfish   172 ----------SLIVCILAI---VDPY--NNPIPQGLE-AFTV-GFSVL---IIGLSMG--FNSGY 214

  Fly   270 AVNQSRQPGSRLKTP------------NY----PIWITSCTGHFGVIFNKNPDLLRNYHAE 314
            |||.:|..|.||.|.            :|    ||:........|||..:   |:..:|.|
Zfish   215 AVNPARDFGPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGAVIGVIVYQ---LMVGWHVE 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14142NP_648447.2 DUF4205 22..433 CDD:290609 45/192 (23%)
aqp3aNP_998633.1 MIP 23..266 CDD:238204 43/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2356
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.