DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IRSp53 and mtss1

Sequence 1:NP_729679.2 Gene:IRSp53 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:XP_009300970.1 Gene:mtss1 ZFINID:ZDB-GENE-081105-141 Length:743 Species:Danio rerio

Alignment Length:1023 Identity:193/1024 (19%)
Similarity:326/1024 (32%) Gaps:374/1024 (37%)


  Fly     1 MEA--EEVTKLVDGVYRNILDRFN---PGARQLIAAGKSYLKALHGAATASRLFNEALAKIA--M 58
            |:|  |:....:.|:::.|::...   |.....:..|......|......:..|.:|..|:|  .
Zfish     1 MDAGMEKECSALGGLFQIIMNDMKASYPAWEDFVTKGAKLQSQLRTTIIVTSSFLDAFQKVADIA 65

  Fly    59 NAQQSGTGDIGSALMSVVNVNKEIQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFLQQH 123
            ...:..|.:|||||..:...::.|:::......|...:|:.|||..:|:..||.....|...:::
Zfish    66 TGTRGATKEIGSALTRMCMRHRSIENKLKLFTTALMDNLITPLELKIEEWKKVASQLDKDHAKEY 130

  Fly   124 -KVRMESYQKAVSTMKKQRKKKATPENTEKELRS-LQ-------LLEDQKKKLDVFCDQSYKNAM 179
             |.|.|..:|:..|:|.|:|.|...:....:|.| ||       :||:.:|:  ..|     .|:
Zfish   131 KKARSEIKKKSSDTIKLQKKVKKGKDEVRMQLDSALQDVNTRYAVLEETEKR--AVC-----RAL 188

  Fly   180 TQERRRYGFVLERQCSIAKHWMVYHTTGKTVIDNN-------------FENWQEIAASREIIPPA 231
            .:||.|:       ||       :.|..|.|:|..             .|:...:.|....:|||
Zfish   189 IEERGRF-------CS-------FVTMLKPVLDEEISMLGEVTHLQTILEDLGNLTADPNTLPPA 239

  Fly   232 A-----------YESGYSTSNGHNNNNISSSSSSGNNNTSGNMRRLERIKDGDDDHLQGHGAQLK 285
            :           |...|.|.....:|.:|..||..:|.||                       ::
Zfish   240 SEQVILDLKGSDYIYSYQTPPASPSNTLSRKSSISSNYTS-----------------------VR 281

  Fly   286 KSRSIDAPYGDMRTLHERENLSGLGGTGPAHYAQNSLPRAKSDFNLALVGTGQSSANKHKIIEEQ 350
            ...|:|:....:..||.|              |.:...|::|                       
Zfish   282 HVPSLDSISSAVDGLHLR--------------APDITQRSRS----------------------- 309

  Fly   351 LATLGDDQRGDQRPLVKALYAYMPSGENQLSFEEGDRIALVGGKAKGWQFGENLRTQHFGWFPVA 415
                         ||:            |:..|||.|....|...                    
Zfish   310 -------------PLL------------QVGGEEGARSLSEGNSP-------------------- 329

  Fly   416 YTNAEVAEVTTSGGRRYENMLMSYERNGGGSGSGSGGGGLRSYQQQQDYEAQLELMESHEATYRR 480
                                  :..|:|                              |...:.|
Zfish   330 ----------------------TVRRSG------------------------------HRGPHLR 342

  Fly   481 RRNHSAEDSSPTRMFGDTIKQQKKYRPGSGANPRPGPPPTLPAPVPNGPQSQSSRMLNSSQSFCA 545
            .|:.....:||....|.::....|...|.....|     ||         |.|.:..::.:....
Zfish   343 HRSTDQGQNSPGTENGTSMPPLHKIYSGHEERVR-----TL---------SSSGKPQSAREQLAL 393

  Fly   546 SNGGGVNAAVERRKQKLLNGVQSSKNHPSGKSGVAAKTSLHSSNDSGFANE-----PPPQPEVDY 605
            :.|||:|:...|..:..|        |.|  ||.:.:|:..|.::....::     .||..:.||
Zfish   394 TLGGGLNSEAPRTSRDSL--------HCS--SGYSTQTTTPSCSEDTIPSQHVIKKEPPLYDYDY 448

  Fly   606 SDEEPATQRVAIRRRADTNSH-----TNTVPRDVASWTLNRNFRNSVDSQ---------IDDKSL 656
                     :::....|.:|.     ::|:||:.   .|:.|:|....|:         :|.:.|
Zfish   449 ---------ISLHGGEDAHSQSDFDKSSTIPRNS---DLSLNYRKMFQSKRPASTVSLLMDPEPL 501

  Fly   657 --H--RLSRQSGGVGKMRYDLIASDDEI-LQASSAGLKRTKSFWKFGGGRNGEDILAGMSLWQHR 716
              |  .:.|:......:|...|:....| :......||.:.|    ..|.:|.|           
Zfish   502 GPHTATIRRKPSSKPNIRRGTISGGVPIPISTPQVPLKASIS----TAGLSGSD----------- 551

  Fly   717 DLVAAPNLEEMRDRDDLERRLEEDRNGTLTKSHNSSSSQEKRERKDSLTSTELYGDEDENIYGVS 781
            |:...|.                     :|:|:....|.....|.:..|||:.........|.:.
Zfish   552 DITCPPG---------------------VTQSNRVPGSDLAHARHNLCTSTQSLSAMPPPYYSMF 595

  Fly   782 PQQPPL-----------QQQTQQHQQHQQHQQQQAQQHRSSYTPKSRMKIMKTIEIDIEEPTEAE 835
            |.|||:           |||...|||.|:..|||.|||   |..|                    
Zfish   596 PGQPPVGSTEPLYQMSKQQQFTLHQQQQRQYQQQQQQH---YNQK-------------------- 637

  Fly   836 RMSTMRRGQSQDQQQQHRKLDKQVSGTGSQHKSLTLSRTKSNQQQQQQQQFPQSTDEGESDEHGT 900
            :.:.....|..:|:.|::::         .||.|   :.|...|.|||.|...:.:.|...|.| 
Zfish   638 QYNQYNHQQQYNQEPQYQQI---------HHKEL---QQKLKHQVQQQVQNTLAHNSGMPSESG- 689

  Fly   901 LKLSDVNN-------FFDGEGKNNSHGHGLVMKTVKRQDILKQYYTSE 941
                 :||       ..||..:.:| |.|.::..::|...|::..|::
Zfish   690 -----LNNSAQPGVDHTDGAPEPSS-GGGDMLSMIRRGVKLRRTLTND 731

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289 54/245 (22%)
SH3_Irsp53_BAIAP2L 364..419 CDD:212713 8/55 (15%)
mtss1XP_009300970.1 I-BAR_IMD_MIM 7..237 CDD:153327 54/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.