DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IRSp53 and BAIAP2L1

Sequence 1:NP_729679.2 Gene:IRSp53 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_061330.2 Gene:BAIAP2L1 HGNCID:21649 Length:511 Species:Homo sapiens

Alignment Length:676 Identity:149/677 (22%)
Similarity:251/677 (37%) Gaps:217/677 (32%)


  Fly     4 EEVTKLVDGVYRNILDRFNPGARQLIAAGKSYLKALHGAATASRLFNEALAKIAMNAQQSGTG-D 67
            |||.:|.:..|||::::||||.|.||..||:|.||::....|.:.:.:.:|||...|..|... :
Human     6 EEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSPVSTE 70

  Fly    68 IGSALMSVVNVNKEIQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFLQQHKVRMESYQK 132
            :|..|:.:.:.:|::.:......|.|:.:::..||..:|.|.|.:....|::..:||.::||.:|
Human    71 LGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLESLEK 135

  Fly   133 AVSTMKKQRKKKATPENT----EKELRSLQLLEDQKKKLDVFCDQSYKNAMTQERRRYGFVLERQ 193
            :.:.:||.|:|.....|.    .||:..::.:..::.::..|.....|.|:.:|:||:.|::::.
Human   136 SQAELKKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKRRFCFLVDKH 200

  Fly   194 CSIAKHWMVYHTTGKTVIDNNFENWQEIAAS------------REIIPPAAYESGYSTSNGHNNN 246
            |..|.|...||.....::::....|||....            .||..||               
Human   201 CGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPA--------------- 250

  Fly   247 NISSSSSSGNNNTSGNMRRLERIKDGDDDHLQGHGAQL---KKSRSIDAPYGDMRTLHERENLSG 308
               |:..||....|..:.|...::. |.|.|.....::   ...|:..:|..||           
Human   251 ---STPVSGTPQASPMIERSNVVRK-DYDTLSKCSPKMPPAPSGRAYTSPLIDM----------- 300

  Fly   309 LGGTGPAHYAQN--------------SLPRAKSDFNLALVGTGQSSANKHKIIEEQLATLGDDQR 359
              ...||..|.|              ||.|:.|      |.||.:...|.|              
Human   301 --FNNPATAAPNSQRVNNSTGTSEDPSLQRSVS------VATGLNMMKKQK-------------- 343

  Fly   360 GDQRPLVKALYAYMPSGENQ--LSFEEGDRIALVGGKAK-GWQFGENLRTQHFGWFPVAYTNAEV 421
                  ||.::.: .:|.|:  |||.:||.|.|:..:.| ||.:||:..::..||||.:||    
Human   344 ------VKTIFPH-TAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYT---- 397

  Fly   422 AEVTTSGGRRYENMLMSYERNGGGSGSGSGGGGLRSYQQQQDYEAQLELMESHEATYRRRRNHSA 486
                                                           :|:|.:|.          
Human   398 -----------------------------------------------KLLEENET---------- 405

  Fly   487 EDSSPTRMFGDTIKQQKKYRPGSGANPRPGPPPTLPAPVPNGPQSQSSRMLNSSQSF-------- 543
                                          ...|:|.|.|...:|.|:..|:.:.|.        
Human   406 ------------------------------EAVTVPTPSPTPVRSISTVNLSENSSVVIPPPDYL 440

  Fly   544 -CASNGGGVNAAVERRKQKLLNGVQSSKNHPSGKSGVAAKTSLHSSNDSGFANEPPPQPEVDYSD 607
             |.|.|    ||.:||       ..|::...:.|: .|:|....:.||:....:||     ..|.
Human   441 ECLSMG----AAADRR-------ADSARTTSTFKA-PASKPETAAPNDANGTAKPP-----FLSG 488

  Fly   608 EEP-ATQRVAIRRRADTNSHTNTVPR 632
            |.| ||.::   |...||..:..:.|
Human   489 ENPFATVKL---RPTVTNDRSAPIIR 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289 63/223 (28%)
SH3_Irsp53_BAIAP2L 364..419 CDD:212713 22/58 (38%)
BAIAP2L1NP_061330.2 I-BAR_IMD_BAIAP2L1 6..231 CDD:153329 63/225 (28%)
SH3_BAIAP2L1 342..399 CDD:212846 23/129 (18%)
Binds F-actin 483..511 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13812831
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001229
OrthoInspector 1 1.000 T609350
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14206
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.