DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IRSp53 and alg10

Sequence 1:NP_729679.2 Gene:IRSp53 FlyBaseID:FBgn0052082 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_001016192.2 Gene:alg10 XenbaseID:XB-GENE-976267 Length:469 Species:Xenopus tropicalis

Alignment Length:35 Identity:10/36 (28%)
Similarity:16/36 (44%) Gaps:8/36 (22%)


  Fly   214 NFENWQEI--------AASREIIPPAAYESGYSTS 240
            :|..|..:        .||..::.|||:..|:|.|
 Frog    52 HFNQWDPMITTLPGLYLASVGMVKPAAWLFGWSDS 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IRSp53NP_729679.2 I-BAR_IMD 4..222 CDD:153289 2/16 (13%)
SH3_Irsp53_BAIAP2L 364..419 CDD:212713
alg10NP_001016192.2 DIE2_ALG10 31..423 CDD:309863 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.