DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufd1-like and AT2G29070

DIOPT Version :8

Sequence 1:NP_524023.1 Gene:Ufd1-like / 39254 FlyBaseID:FBgn0036136 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_973557.1 Gene:AT2G29070 / 817455 AraportID:AT2G29070 Length:312 Species:Arabidopsis thaliana

Alignment Length:315 Identity:123/316 (39%)
Similarity:179/316 (57%) Gaps:41/316 (13%)


  Fly    13 EGRNFHANYKCFSVSMLPGNERTDVEKGGKIIMPPSALDTLTRLNVEYPMLFKLTNVKKSRSSHA 77
            :|.:|...|:|:.|:.:   ::..:|||.||||||||||.|..|::||||||:|:||...::||.
plant     4 DGSSFEQCYRCYPVTFI---DKAHLEKGDKIIMPPSALDRLASLHIEYPMLFQLSNVSVEKTSHC 65

  Fly    78 GVLEFVADEGKCYLPHWMMENLLLGEGDILNIESVSLPVATFSKFQPHSTDFLDITNPKAVLENA 142
            |||||.||||..|||:|||:|:.|.|||::.::::||...|:.|.|||:.|||||:||||:||..
plant    66 GVLEFTADEGLVYLPYWMMQNMSLEEGDVMQVKNISLVKGTYIKLQPHTQDFLDISNPKAILETT 130

  Fly   143 LRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKDHSETQASGSGQ 207
            ||:::|||.||.|.:.||.|.|.:.|:|.||.:||||||.|..|:|..|:.||:..:.|      
plant   131 LRSYSCLTTGDTIMVPYNNKQYYINVVEAKPSSAVSIIETDCEVDFAPPLDYKEPEKPQ------ 189

  Fly   208 QGAAGTVGGEIAGATNAILEEVVE-----------TFKGSGVRLDGKKKKESQLE-TPVVKKVLA 260
                     ::..:....|:...|           .|.|||.|||||.:.:::.| |...:|...
plant   190 ---------KLTPSNKRPLQVKEEEEPASKVPKFTPFTGSGKRLDGKAQTQTEPEDTKQQEKPTE 245

  Fly   261 RGVPDYDFQF-------GLIRFDRNIRPIS-DRSQEDD---AVAGNADASDAESF 304
            .|..|.....       |.:.|..|.:..: :.::.||   .|..::..||...|
plant   246 NGKDDEKLSVTTPRQISGKLVFGSNSKSAAKETAKVDDPKNIVQESSTKSDEAKF 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ufd1-likeNP_524023.1 UFD1 4..316 CDD:227469 123/316 (39%)
UFD1 17..190 CDD:281187 93/173 (54%)
AT2G29070NP_973557.1 UFD1 8..178 CDD:281187 93/173 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I1147
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1134444at2759
OrthoInspector 1 1.000 T124910
orthoMCL 1 0.900 OOG5_127577
Panther 1 1.100 O PTHR12555
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.