DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxK and Foxj2

DIOPT Version :8

Sequence 1:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_006237373.1 Gene:Foxj2 / 502886 RGDID:1565101 Length:623 Species:Rattus norvegicus

Alignment Length:456 Identity:122/457 (27%)
Similarity:169/457 (37%) Gaps:160/457 (35%)


  Fly   386 LKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQDLFQTPSTASYNH 450
            |:.:|.|....|....|.||...:...|..|.....:::                     ||.:.
  Rat    60 LRATIEKLGSASQAGPPGGTRKCSPGSPTDPNATLSKDE---------------------ASVHQ 103

  Fly   451 NEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKV 515
            :.||.||||.||..||:::|.|::|||.||.:|..::||| |....||:||||||||||:.|.||
  Rat   104 DGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYY-KNAGIGWKNSIRHNLSLNKCFRKV 167

  Fly   516 ARSQDEPGKGSFWRID--PDSGAK--------LIDHSYKKRRQRSSQGFRPPYGMPRSAPVSPSH 570
            .|.:|:|||||:|.||  ||...|        |...|.::...:|.:|     |:|.|...|.||
  Rat   168 PRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRG-----GVPGSGEASLSH 227

  Fly   571 MDNSRESSPLQDIVLQS-------------------APGSPGM---------------------- 594
            ..|.:.|       |||                   |.|:||.                      
  Rat   228 EGNPQMS-------LQSPSSMASYSQGPGPVDGGAVAAGAPGQESTEGAPPLYNTNHDFKFSYSE 285

  Fly   595 ---------------SLEQRAADPE----------------IIYNSQNAHQQQQQQQQQQQQQTL 628
                           |:.:|::..:                .:|..|...|||||||||||||..
  Rat   286 INFQDLSWSFRNLYKSMLERSSSSQHGFSSLLGDMPPSNNYYMYQQQQQQQQQQQQQQQQQQQQQ 350

  Fly   629 SNN-------------------------SNQYSSGSPYYVTNQSSGVATPQTHVEGSAASGGGGG 668
            ...                         ||  ..|:|...|....|..||.....|:...|...|
  Rat   351 QQQQPPPQPQPPPQQPQPQQQQAPTQGPSN--VGGAPPLHTPSPDGCTTPGGKQAGAEVYGPPTG 413

  Fly   669 GGVGALLALKRNHVMGGGASQHTLH----------QQQAVAQQQHSEIIYEELPTDYSGHIEASE 723
                  :|:....:..||...|..|          ||||.:|...:...: ..|.|:..:|::.:
  Rat   414 ------MAMHPPPLQHGGYHPHQHHPHSHPAQQPPQQQAQSQAPINSTGF-AFPPDWCSNIDSLK 471

  Fly   724 E 724
            |
  Rat   472 E 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 51/97 (53%)
Foxj2XP_006237373.1 Forkhead 106..183 CDD:278670 46/78 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.