DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod1 and sodC

DIOPT Version :9

Sequence 1:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_416163.1 Gene:sodC / 945343 ECOCYCID:G6886 Length:173 Species:Escherichia coli


Alignment Length:155 Identity:44/155 - (28%)
Similarity:62/155 - (40%) Gaps:34/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGD--------NTNGCMSSGPHFNPY- 66
            |.:.|:|...:...|  ::.|.::..|..|.||||:|..|.        ..:...|:|.|.:|. 
E. coli    35 GQSIGSVTITETDKG--LEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQN 97

  Fly    67 -GKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKIT-------LFGADSIIGRTVVVHADAD 123
             ||..|.  :...|||||         |..|...|.|.|       |...|.|..:.::||...|
E. coli    98 TGKHEGP--EGAGHLGDL---------PALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGD 151

  Fly   124 DLGQGGHELSKSTGNAGARIGCGVI 148
            ::.    :..|..|..|.|..||||
E. coli   152 NMS----DQPKPLGGGGERYACGVI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 44/155 (28%)
sodCNP_416163.1 PRK10290 1..173 CDD:182357 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I612
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Inparanoid 1 1.050 57 1.000 Inparanoid score I436
OMA 1 1.010 - - QHG61834
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 1 1.000 - -
109.970

Return to query results.
Submit another query.