DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: APP-BP1 and UBA6

Sequence 1:NP_001261699.1 Gene:APP-BP1 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_060697.4 Gene:UBA6 HGNCID:25581 Length:1052 Species:Homo sapiens

Alignment Length:510 Identity:101/511 (20%)
Similarity:177/511 (35%) Gaps:143/511 (28%)


  Fly     8 SPELSDKSKKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKE 72
            |.|:.|  ..|.||..:.|:.....:..:.|.|..:..:|.|.||.|||.||...|:.|....:.
Human    36 SVEIDD--ALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQA 98

  Fly    73 EDLGNNFFL--DSSYLGKSKALACMQLLQELNPDVNGDYVDESADFLLANRPNFFDSFDLVIASN 135
            .|||.||||  |.....:::|.|.::.:.||||.|:  ....|..|......:|.|.:..|:   
Human    99 WDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVH--VTSSSVPFNETTDLSFLDKYQCVV--- 158

  Fly   136 LNEQTLLLLAERLWELNVPLIYCRSLGMLGTIRLQIREHCIVEAHPDNRQFDLRLEHPFDALREH 200
                        |.|:.:||            :.:|.:.|..:..|..          |.:...|
Human   159 ------------LTEMKLPL------------QKKINDFCRSQCPPIK----------FISADVH 189

  Fly   201 LDGTEVTSKVPWLLVLHKYLNVWQKQQADGTQTPRNYKEKNQLKETIREEMKADEENYEEAIKAV 265
                                .:|.:...|       :.::.::.:|..||.|   |.:...|...
Human   190 --------------------GIWSRLFCD-------FGDEFEVLDTTGEEPK---EIFISNITQA 224

  Fly   266 NTAFGAGQVPKSLKAIFEDDACEQLNKKSNVFWIMAKALKHFVIHENEGHLPLPGVLPDMTANTD 330
            |        |..:..:                             ||..|          ...|.
Human   225 N--------PGIVTCL-----------------------------ENHPH----------KLETG 242

  Fly   331 SYIALQHIYRQQALQDADQVYHKCQEYLKQLALPAD---SIDERSVRLICKEAAGLAVIRGTRIA 392
            .::..:.|.....|..:          ::|:.:.:.   ||.: :..|......|:||...|...
Human   243 QFLTFREINGMTGLNGS----------IQQITVISPFSFSIGD-TTELEPYLHGGIAVQVKTPKT 296

  Fly   393 EEYEKSSRLLP-----LVEDNELQGNLTAYNFALRAYERFLSECGNIPG-ECIVEQDIGRLKSIA 451
            ..:|...|.|.     :|:.:..:..|..:. |:.|.::|..:....|. .|  :||...|..:|
Human   297 VFFESLERQLKHPKCLIVDFSNPEAPLEIHT-AMLALDQFQEKYSRKPNVGC--QQDSEELLKLA 358

  Fly   452 AKMLSDLGMHATISDDVLHEICRYGGAELHAVSAFIGGCAAQEVIKIITKQYKPI 506
            ..:...|.....::.|::|.:.......|..::|.:||.|:|||:|.:|.::.|:
Human   359 TSISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGGVASQEVLKAVTGKFSPL 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 98/503 (19%)
ThiF 17..>171 CDD:223552 41/156 (26%)
UBA6NP_060697.4 Ube1 38..1046 CDD:273603 100/509 (20%)
Ube1_repeat1 43..432 CDD:238768 98/502 (20%)
E1_4HB 299..361 CDD:292809 14/65 (22%)
Ube1_repeat2 462..1005 CDD:238767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.