DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: APP-BP1 and Aos1

Sequence 1:NP_001261699.1 Gene:APP-BP1 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_650198.1 Gene:Aos1 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster

Alignment Length:510 Identity:98/511 (19%)
Similarity:155/511 (30%) Gaps:199/511 (39%)


  Fly    10 ELSD-KSKKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEE 73
            ||:: :::.|||||||||...|..|..|.:.:..:..:|.|..|.::|.|:....:.|...|.||
  Fly    13 ELTEAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEE 77

  Fly    74 DLGNNFFLDSSYLGKSKALACMQLLQELNPDVNGDYVDESADF--LLANRPNFFDSFDLVIASNL 136
            |..:.|.:....|..::|.|.:...:.|||     .||.|||.  |......||..||:|:.:..
  Fly    78 DFCSQFLVPRESLNTNRAEASLTRARALNP-----MVDISADREPLKEKTSEFFGQFDVVVVNGA 137

  Fly   137 NEQTLLLLAERLWELNVPLIYCRSLGMLGTIRLQIREHCIVEAHPDNRQFDLRLEHPFDALREHL 201
            ..:.||.:.....:|.|..|.....|..|.....:::|..||                |.::   
  Fly   138 TNEELLRIDTICRDLGVKFIATDVWGTFGFYFASLQKHSYVE----------------DVIK--- 183

  Fly   202 DGTEVTSKVPWLLVLHKYLNVWQKQQADGTQTPRNYKEKNQLKETIREEMKADEENYEEAIKAVN 266
                           ||.:             ..:.|:|.....:|..:...|...|..      
  Fly   184 ---------------HKVV-------------ANSEKKKKYETVSIPTQRDVDYPGYSA------ 214

  Fly   267 TAFGAGQVPKSLKAIFEDDACEQLNKKSNVFWIMAKALKHFVIHENEGHLPLPGVLPDMTANTDS 331
                                           |:      .|.:.|       |..|..:..|...
  Fly   215 -------------------------------WL------DFDVTE-------PSYLRKLKRNGPG 235

  Fly   332 YIALQHIYRQQALQDADQVYHKCQEYLKQLALPADSIDERSVRLICKEAAGLAVIRGTRIAEEYE 396
            .:.|..:.:.:.....|..| |.:|                        |.|.::||.|      
  Fly   236 VLLLSVLQKFRTTHKRDPSY-KTRE------------------------ADLELLRGIR------ 269

  Fly   397 KSSRLLPLVEDNELQGNLTAYNFALRAYERFLSECGNIPGECIVEQDIGRLKSIAAKMLSDLGMH 461
              ..|||                                                         :
  Fly   270 --DELLP---------------------------------------------------------N 275

  Fly   462 ATISDDVLHEICRYGGAELHAVSAFIGGCAAQEVIKIITKQYKPIDNTFIYNAIT 516
            :.:.|:.|..|.    |::....|.:||..||||||::||...|..|.|:::..|
  Fly   276 SILGDEALGLIF----AQISPAVAVVGGVVAQEVIKVVTKLEAPHRNLFVFDPET 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 96/504 (19%)
ThiF 17..>171 CDD:223552 47/156 (30%)
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 47/158 (30%)
ThiF 22..>167 CDD:279270 47/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120002077
eggNOG 1 0.900 E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10953
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1600
43.960

Return to query results.
Submit another query.