DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mocs1 and Mocs1

Sequence 1:NP_788494.1 Gene:Mocs1 FlyBaseID:FBgn0263241 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_064426.2 Gene:Mocs1 MGIID:1928904 Length:636 Species:Mus musculus

Alignment Length:650 Identity:310/650 (48%)
Similarity:400/650 (62%) Gaps:114/650 (18%)


  Fly     3 LLARHA---IRLLGQENSAGEVASLSRGAIRLKATTGYLNLATASVQPLEPEK-------QVLRK 57
            :.||.|   :|.|.:.|:.|    .|.||...:...|         :|..|.:       |.|::
Mouse     1 MAARPAFGIVRQLLRSNARG----CSSGAPVTQPRPG---------EPSRPTREGLSLRLQFLQE 52

  Fly    58 NSP-----LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQ 117
            ::.     |||||||.|:||||||||:|||||.||||.|||||.||..||||||||.|||:||::
Mouse    53 HAAPFSAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKE 117

  Fly   118 GVRKIRLTGGEPTVRRDIVEIVAQMKALPELEQIGITTNGLVLTRLLLPLQRAGLDNLNISLDTL 182
            ||.|||||||||.:|.|:|:|||::..|..|..||:||||:.|.|||..||:|||:.:|||||||
Mouse   118 GVDKIRLTGGEPLIRPDVVDIVARLHGLEGLRTIGLTTNGINLARLLPRLQQAGLNAVNISLDTL 182

  Fly   183 KRDRFEKITRRKGWERVIAGIDLAVQLGYRP-KVNCVLMRDFNEDEICDFVEFTRNRPVDVRFIE 246
            ...:||.|.||||:.:|:.||..|::|||:| |||||:||..||||:.|||..|...|:||||||
Mouse   183 VPAKFEFIVRRKGFHKVMEGIHKAIELGYKPVKVNCVVMRGLNEDELLDFVALTEGLPLDVRFIE 247

  Fly   247 YMPFSGNKWHTERLISYKDTLQIIRQRWPDFKALPNGPNDTSKAYAVPGFKGQVGFITSMTEHFC 311
            ||||.||||:.::::|||:.|..||||||..:.||...:.|:||:.:|||:||:.|||||:||||
Mouse   248 YMPFDGNKWNFKKMVSYKEMLDTIRQRWPGLEKLPEEDSSTAKAFKIPGFQGQISFITSMSEHFC 312

  Fly   312 GTCNRLRLTADGNIKVCLFGNKEFSLRDAMRDESVSEEQLVDLIGAAVQRKKKQHA--------- 367
            |||||||:|||||:|||||||.|.||||.:| ...|||:|:.:|||||.|||:|||         
Mouse   313 GTCNRLRITADGNLKVCLFGNSEVSLRDHLR-AGASEEELLRIIGAAVGRKKRQHAGMFNIAQMK 376

  Fly   368 ----------------------------------------------------------------- 367
                                                                             
Mouse   377 NRPMILIGVLLMLQDSPPARWSNFSWDPLRVRNPSARQCLSDQMASLWKRHCIPKALPLSQQCLG 441

  Fly   368 DAAPRLHHHLHPYSYHHAYHTSRLQLQARN--------YSQLTHVDGQGKAQMVDVGAKPSTTRL 424
            ..:|:.|:..:|....|:...| ...||.:        .:||||||..|:|.|||||.||.|.|:
Mouse   442 SGSPQRHYSSYPDPDTHSKCLS-TGSQAPDAPSGPGPTSNQLTHVDSAGRASMVDVGGKPETERV 505

  Fly   425 ARAEATVQVGEKLTQLIADNQVAKGDVLTVAQIAGIMGAKRTAELIPLCHNISLSSVKVQATLLK 489
            |.|.|.|.:|....:|:..||:.|||.|.|||:||:..||.|::||||||:::||.|:|...|..
Mouse   506 AVASAMVLLGPVAFKLVQQNQLKKGDALVVAQLAGVQAAKLTSQLIPLCHHVALSHVQVHLELDS 570

  Fly   490 TEQSVRLEATVRCSGQTGVEMEALTAVSVAALTVYDMCKAVSHDICITNVRLLSKSGGKR-DFQR 553
            |..:|.::|:.|..|.|||||||||:.::|||||||||||||.||.:|.|:|:||:||:| ||.|
Mouse   571 TRHAVLIQASCRARGPTGVEMEALTSAAMAALTVYDMCKAVSRDIVVTEVKLISKTGGQRGDFHR 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mocs1NP_788494.1 moaA 59..366 CDD:234672 198/313 (63%)
Radical_SAM 74..249 CDD:100105 114/176 (65%)
Mob_synth_C 240..367 CDD:283994 82/127 (65%)
moaC 399..555 CDD:236483 88/156 (56%)
Mocs1NP_064426.2 Molybdenum cofactor biosynthesis protein A 1..383 219/472 (46%)
PLN02951 16..384 CDD:215513 213/455 (47%)
Radical_SAM 74..272 CDD:100105 126/199 (63%)
Mob_synth_C 241..367 CDD:283994 81/200 (41%)
GTP binding. {ECO:0000250} 317..319 1/2 (50%)
Molybdenum cofactor biosynthesis protein C 414..636 76/139 (55%)
moaC 479..635 CDD:236483 43/74 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190310064
eggNOG 1 0.900 E1_COG2896
Hieranoid 1 1.000
Homologene 1 1.000 H4343
Inparanoid 1 1.050 583 1.000 Inparanoid score I1001
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004715
OrthoInspector 1 1.000 T1083337
orthoMCL 1 0.900 OOG5_128145
Panther 1 1.100 LDO PTHR22960
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4665
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.