DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43693 and CG32081

Sequence 1:NP_001261694.1 Gene:CG43693 FlyBaseID:FBgn0263776 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_729646.1 Gene:CG32081 FlyBaseID:FBgn0052081 Length:471 Species:Drosophila melanogaster

Alignment Length:435 Identity:145/436 (33%)
Similarity:247/436 (57%) Gaps:12/436 (3%)


  Fly   144 EDGNYNPFEHRKVEHPTSDLETFVHLLKGSLGSGILAMPMAFSHAGLWFGLVATFAVGTLCTYCV 208
            :.|.::|:|:|.|.||.||:..|..|||..:|:|::|:|::|::||:..|::...:|..:..:.:
  Fly     3 DKGGFDPYENRNVAHPISDIGAFFSLLKCVVGTGVMAIPLSFNYAGIVTGIILLVSVCFMLIHGM 67

  Fly   209 HILVKCAHILCRRRKIPMMGFAD---VAEQAFLDGPPALNRWSRFIRFMVNTFLVIDLLGCCCIY 270
            .:|:.|. |.|.||.  .:|:|.   ....:|..||......|:..|::|:..|.....|.|.:|
  Fly    68 QMLIICM-IECSRRM--QIGYATYPVAMVYSFDQGPRFFKYISKAGRYIVDGVLAFSQFGVCVVY 129

  Fly   271 LVFVATNVEQVVRVYMETELSIRVWIMIVTAPLIFMCLVRNLKFLTPFSMIANILMFVGIVITFI 335
            .||||..::|:|..|. ....:|::|.::...||....:|.||:|.||:::|:||::.|..:...
  Fly   130 NVFVAATLKQLVDFYW-VVADLRIYIAVIALCLIPPFQIRKLKYLVPFNILASILIYTGFSLMMY 193

  Fly   336 YMFSDIPAPVERPGIVS-VTEWPLFFGTVIFALEGIGVVMSLENDMKNPSHFIGCPSVLNFGMGL 399
            |:|.|:|...||..:.. :.:.|||||..:|::..:||::::|..|..|.|::|...:|:..:.|
  Fly   194 YLFVDLPPITERNILFGRIDKIPLFFGIALFSITSVGVMLAVEATMAKPRHYLGWFGILDRAILL 258

  Fly   400 VIALYTLVGFFGFLKYGPETQASITLNLPLEDKLAQSVKLMIAIAIFFTFTLQFYVPVTILWKGL 464
            ||..|...|..|:.:||.||..||:||:|.::.|:|..|..||.|||.|:.|..:|.:.|:....
  Fly   259 VIISYVTFGLMGYWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHF 323

  Fly   465 EHKIRPEKQN--ISEYGLRVFLVLLCGGIAVALPNLGPFISLIGAVCLSTLGMIVPATIELAVYH 527
            .:| ..:..|  :.|..||...|:|....|:..|||||.:||:||:.:|.|.::.||.||:.:|:
  Fly   324 WNK-NGDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLYY 387

  Fly   528 -EDPGYGRFNWRLWKNSGLILFGVVGFVAGTYVSIIEFHAEFSSG 571
             .:..||:..|.|.|:...::.|::..|.||..||.:..:|:..|
  Fly   388 PPEYNYGKLKWVLVKDIFYVIVGILILVQGTVFSIKDMISEWGGG 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43693NP_001261694.1 SdaC 153..561 CDD:223884 139/415 (33%)
SLC5-6-like_sbd 158..562 CDD:294310 138/411 (34%)
CG32081NP_729646.1 SLC5-6-like_sbd 17..422 CDD:294310 137/410 (33%)
SdaC 20..415 CDD:223884 131/400 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1577
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D284074at33208
OrthoFinder 1 1.000 FOG0000215
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22950
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.