DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr65Ea

DIOPT Version :9

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:117 Identity:55/117 - (47%)
Similarity:74/117 - (63%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHAN 65
            |::.|||. |:..||. ||..|.:.   |||..::...:|.|.|..|.::||..:|.|:.|:.|:
  Fly     1 MYKLLLVV-ALFGCAL-AAPLNDDT---ITKFLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAH 60

  Fly    66 GGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117
            |.:|:.||||..||:.|.|||.|:.||..|||||||||..||||:.||:.||
  Fly    61 GSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 21/46 (46%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 21/46 (46%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.