DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr65Ea

DIOPT Version :8

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster

Alignment Length:117 Identity:55/118 (47%)
Similarity:74/118 (63%) Gaps:5/118 (4%)


  Fly     1 MFRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHAN 65
            |::.|||. |:..||. ||..|.:.   |||..::...:|.|.|..|.::||..:|.|:.|:.|:
  Fly     1 MYKLLLVV-ALFGCAL-AAPLNDDT---ITKFLANQDTDGTYAYDIEQASGIQIKEEGLAGHEAH 60

  Fly    66 GGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117
            |.:|:.||||..||:.|.|||.|:.||..|||||||||..||||:.||:.||
  Fly    61 GSYSYISPEGIPVQVVYTADEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHP 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 22/47 (47%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:278791 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48852
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.