DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Acp65Aa

DIOPT Version :10

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:32/105 - (30%)
Similarity:53/105 - (50%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGN--- 62
            |.:.:||..:| |.....|:...:....:.:..|:....|.|.:.|:.|:|.:..|.|:..|   
  Fly     1 MMKLMLVVGSI-ALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGT 64

  Fly    63 -----HANGGFSWYSPEGELVQISYVADENGYQPQGALLP 97
                 ...|..:|.:|:|:...|::||||||:||:||.||
  Fly    65 DNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 17/54 (31%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.