DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Acp65Aa

DIOPT Version :8

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster

Alignment Length:105 Identity:32/106 (30%)
Similarity:53/106 (50%) Gaps:9/106 (8%)


  Fly     1 MFRYLLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGN--- 62
            |.:.:||..:| |.....|:...:....:.:..|:....|.|.:.|:.|:|.:..|.|:..|   
  Fly     1 MMKLMLVVGSI-ALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGT 64

  Fly    63 -----HANGGFSWYSPEGELVQISYVADENGYQPQGALLP 97
                 ...|..:|.:|:|:...|::||||||:||:||.||
  Fly    65 DNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 18/55 (33%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.