DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr67Fa1 and Cpr49Ab

DIOPT Version :8

Sequence 1:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster

Alignment Length:107 Identity:36/108 (33%)
Similarity:56/108 (52%) Gaps:8/108 (7%)


  Fly    17 GAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESG-------IGGNHANGGFSWYSPE 74
            |..|.....|..|.:...|::.:| |:|.:||.|||..:|||       ..|..:.|.:.:..|:
  Fly   149 GRGTGEGGNGWAIIRQEDDVEVDG-YHYLWETENGILGEESGRIEKLTEEEGLRSKGFYEYTGPD 212

  Fly    75 GELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTH 116
            |.|.::.||||:||:.|..|.|||.||.|..:.:.|.::..:
  Fly   213 GILYRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLEAN 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 21/54 (39%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47944
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.