DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OXA1L and cox18

DIOPT Version :9

Sequence 1:NP_648417.1 Gene:OXA1L / 39222 FlyBaseID:FBgn0027615 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001016333.1 Gene:cox18 / 549087 XenbaseID:XB-GENE-1008496 Length:381 Species:Xenopus tropicalis


Alignment Length:263 Identity:71/263 - (26%)
Similarity:121/263 - (46%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 GW-------SPVGMVQNCLEFLHCTWDIPWWGTIAIGTLAVR-TIIFPLVILAQRNSAKMNNNMP 186
            ||       :||.:.::.|..||.|..:|||..|...|:::| ||..||.:......||:.|..|
 Frog   100 GWYESLADTAPVNLAESMLISLHETSGMPWWANIICATVSLRTTITLPLSVYQMYILAKVENLQP 164

  Fly   187 QMQML--QLK---MTEARQSGNAIESARYAQEMM-------LFMREKGVNPLKNMVVPLAQAPLF 239
            ::..|  ||:   ....:|.|...:.||:.....       |::|: ..:|.|..::...|.|::
 Frog   165 EIDALAKQLRYEVSVYGKQHGWTDKVARFQFRKNLRRIISGLYVRD-NCHPFKASLLIWIQIPMW 228

  Fly   240 ISFFMGLRQMA---------NAPVESMRDGGLFWFTDLTMADPFYLLPLITSATLYLTIEI---- 291
            |...:.||.::         :|..:.:.:|||.||.||||.|..::||:.......|.:||    
 Frog   229 IFVSIALRNISLNRADSATGDAVQKQLTEGGLLWFPDLTMPDSTWILPVTLGLLNLLIVEIFALR 293

  Fly   292 GTDSARLSAANMNTMKYVLRALPIVIFPFTMNFPAAILTYWACSNFISLGQVAVLRIPSVREYFK 356
            ..:.:|......|    .:||:.|.:.|.....|:::..||..|:.:.|....:||.|::|..|:
 Frog   294 KIELSRFQKIITN----FIRAVSIAMIPIASTVPSSMALYWVTSSCVGLAHNLLLRSPALRRVFR 354

  Fly   357 IEK 359
            |.:
 Frog   355 IPR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OXA1LNP_648417.1 yidC_oxa1_cterm 152..342 CDD:274665 56/215 (26%)
cox18NP_001016333.1 60KD_IMP <117..351 CDD:294333 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495015at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.