DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and CIA2

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_011990.1 Gene:CIA2 SGDID:S000001164 Length:231 Species:Saccharomyces cerevisiae

Alignment Length:149 Identity:79/150 (53%)
Similarity:99/150 (66%) Gaps:14/150 (9%)


  Fly    18 ERVLTANEEDENV---------PDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQN 73
            |..|.|..|||:|         ||..|.:||:|||.:|:||||||:|.:|.||..:.|.::||.|
Yeast    79 EDSLPAESEDESVAGGGKEEEEPDLIDAQEIYDLIAHISDPEHPLSLGQLSVVNLEDIDVHDSGN 143

  Fly    74 -----SVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKE 133
                 .|.|..||||.|||:||||||.|||:|.|||||||::|:.:..|||.||..|||||.|||
Yeast   144 QNEMAEVVIKITPTITHCSLATLIGLGIRVRLERSLPPRFRITILLKKGTHDSENQVNKQLNDKE 208

  Fly   134 RVAAALENNHLAEVINQCI 152
            |||||.||..|..|:::.:
Yeast   209 RVAAACENEQLLGVVSKML 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 79/150 (53%)
CIA2NP_011990.1 COG5133 1..231 CDD:227462 79/150 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21434965
eggNOG 1 0.900 E1_COG5133
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 139 1.000 Inparanoid score I1172
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T1136665
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1897
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.