DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and AE7

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_176998.1 Gene:AE7 AraportID:AT1G68310 Length:159 Species:Arabidopsis thaliana

Alignment Length:159 Identity:83/160 (52%)
Similarity:117/160 (73%) Gaps:5/160 (3%)


  Fly     1 MPTEIENINPNVYDRIKERVLTANEE--DENVPDPFDKREIFDLI--RNINDPEHPLTLEELHVV 61
            |.:.:.|.||.:|.: |||.|..:..  ||..|:|.|:.||||::  .||.|||||.|||:|.||
plant     1 MVSGLINENPIIYPK-KERRLRTDTSITDELTPEPIDQLEIFDILSSSNIKDPEHPNTLEDLRVV 64

  Fly    62 QEDLIRINDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVN 126
            .||.:.::|..:.|.::||||:.||||||:|||.:|||||||||.|:|:.:.:.||:||:|.|:|
plant    65 TEDSVEVDDENSYVRVTFTPTVEHCSMATVIGLCVRVKLLRSLPSRYKIDIRVAPGSHATEDALN 129

  Fly   127 KQLADKERVAAALENNHLAEVINQCIAAK 155
            |||.|||||||||||.:|.|::::|:.::
plant   130 KQLNDKERVAAALENPNLVEMVDECLPSE 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 83/157 (53%)
AE7NP_176998.1 DUF59 <23..157 CDD:294611 74/134 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 171 1.000 Inparanoid score I1492
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoInspector 1 1.000 T124220
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 O PTHR12377
Phylome 1 0.910 0.609 Consistency score
98.980

Return to query results.
Submit another query.