DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and AT3G09380

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_187549.2 Gene:AT3G09380 AraportID:AT3G09380 Length:149 Species:Arabidopsis thaliana

Alignment Length:151 Identity:71/152 (47%)
Similarity:99/152 (65%) Gaps:8/152 (5%)


  Fly     1 MPTEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHP-LTLEELHVVQED 64
            |.:.:.|.||.:|.:...|..|    |::..|.|...   :.||:|.||||| |:||:|:|:.|:
plant     1 MDSVLTNKNPIIYPKRTRRYRT----DQSSTDEFSST---NRIRDIKDPEHPELSLEDLNVLTEE 58

  Fly    65 LIRINDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQL 129
            .:.::|.::.|.|:||||:|||.:.|.|||.|.|||::|||.||||.|.:.||:|..|..|||||
plant    59 SVEVDDHKSYVRITFTPTLPHCHLPTHIGLCILVKLVQSLPARFKVDVRVAPGSHDKETTVNKQL 123

  Fly   130 ADKERVAAALENNHLAEVINQ 150
            .|||||.|||||..|..::|:
plant   124 GDKERVTAALENPELVALLNK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 71/152 (47%)
AT3G09380NP_187549.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1492
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12377
Phylome 00.000 Not matched by this tool.
55.170

Return to query results.
Submit another query.