DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and AT3G09380

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_187549.2 Gene:AT3G09380 / 820096 AraportID:AT3G09380 Length:149 Species:Arabidopsis thaliana


Alignment Length:151 Identity:71/151 - (47%)
Similarity:99/151 - (65%) Gaps:8/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHP-LTLEELHVVQED 64
            |.:.:.|.||.:|.:...|..|    |::..|.|...   :.||:|.||||| |:||:|:|:.|:
plant     1 MDSVLTNKNPIIYPKRTRRYRT----DQSSTDEFSST---NRIRDIKDPEHPELSLEDLNVLTEE 58

  Fly    65 LIRINDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQL 129
            .:.::|.::.|.|:||||:|||.:.|.|||.|.|||::|||.||||.|.:.||:|..|..|||||
plant    59 SVEVDDHKSYVRITFTPTLPHCHLPTHIGLCILVKLVQSLPARFKVDVRVAPGSHDKETTVNKQL 123

  Fly   130 ADKERVAAALENNHLAEVINQ 150
            .|||||.|||||..|..::|:
plant   124 GDKERVTAALENPELVALLNK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 71/151 (47%)
AT3G09380NP_187549.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1533
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12377
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.