DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and Ciao2b

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001138326.1 Gene:Ciao2b RGDID:1585802 Length:165 Species:Rattus norvegicus

Alignment Length:151 Identity:109/152 (72%)
Similarity:131/152 (86%) Gaps:0/152 (0%)


  Fly     5 IENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRIN 69
            :||.||.:|:|..||.:||.||||.|||..|.||||||||:|||||||||||||:||::..|:::
  Rat    14 LENANPLIYERSGERPVTAGEEDEEVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRIQVS 78

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:::|.::||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||||
  Rat    79 DPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKER 143

  Fly   135 VAAALENNHLAEVINQCIAAK 155
            |||||||.||.||:|||::|:
  Rat   144 VAAALENTHLLEVVNQCLSAR 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 108/149 (72%)
Ciao2bNP_001138326.1 DUF59 <25..163 CDD:294611 102/138 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21341704
eggNOG 1 0.900 E1_COG5133
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 225 1.000 Inparanoid score I3363
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T1088480
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.