DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and ciao2b

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001128276.1 Gene:ciao2b XenbaseID:XB-GENE-5959878 Length:160 Species:Xenopus tropicalis

Alignment Length:153 Identity:108/154 (70%)
Similarity:130/154 (84%) Gaps:0/154 (0%)


  Fly     3 TEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR 67
            :::||.||.:|.|..||.:||.||||:.||..|.||||||||.|||||||||||||:||:|..::
 Frog     5 SQLENANPLIYRRAGERQVTAQEEDEDAPDRIDDREIFDLIRCINDPEHPLTLEELNVVEEIRVK 69

  Fly    68 INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADK 132
            ::|.:::|.:.||||||||||||||||||:||||||||.||||.|.|||||||||.|||||||||
 Frog    70 VSDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPERFKVDVHITPGTHASEHAVNKQLADK 134

  Fly   133 ERVAAALENNHLAEVINQCIAAK 155
            |||||||||:||.||:|||::.:
 Frog   135 ERVAAALENSHLLEVVNQCLSGR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 108/151 (72%)
ciao2bNP_001128276.1 DUF59 5..154 CDD:294611 108/149 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21341606
eggNOG 1 0.900 E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6115
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.