DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and CIAO2B

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_057146.1 Gene:CIAO2B / 51647 HGNCID:24261 Length:163 Species:Homo sapiens


Alignment Length:151 Identity:108/151 - (71%)
Similarity:130/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRIN 69
            :||.||.:|.|..||.:||.||||.|||..|.||||||||:|||||||||||||:||::..::::
Human    12 LENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVS 76

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:::|.::||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||||
Human    77 DPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKER 141

  Fly   135 VAAALENNHLAEVINQCIAAK 155
            |||||||.||.||:|||::|:
Human   142 VAAALENTHLLEVVNQCLSAR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 107/148 (72%)
CIAO2BNP_057146.1 FeS_assembly_P <23..161 CDD:412662 101/137 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155470
Domainoid 1 1.000 118 1.000 Domainoid score I5872
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 223 1.000 Inparanoid score I3535
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto90740
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.