DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and CIAO2B

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_057146.1 Gene:CIAO2B HGNCID:24261 Length:163 Species:Homo sapiens

Alignment Length:151 Identity:108/152 (71%)
Similarity:130/152 (86%) Gaps:0/152 (0%)


  Fly     5 IENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRIN 69
            :||.||.:|.|..||.:||.||||.|||..|.||||||||:|||||||||||||:||::..::::
Human    12 LENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVS 76

  Fly    70 DSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKER 134
            |.:::|.::||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||||
Human    77 DPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKER 141

  Fly   135 VAAALENNHLAEVINQCIAAK 155
            |||||||.||.||:|||::|:
Human   142 VAAALENTHLLEVVNQCLSAR 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 107/149 (72%)
CIAO2BNP_057146.1 DUF59 <23..161 CDD:294611 101/138 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21341615
eggNOG 1 0.900 E1_COG5133
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 222 1.000 Inparanoid score I3481
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T1074826
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1897
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.