DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and AT3G50845

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001078267.1 Gene:AT3G50845 AraportID:AT3G50845 Length:154 Species:Arabidopsis thaliana

Alignment Length:146 Identity:71/147 (48%)
Similarity:101/147 (69%) Gaps:3/147 (2%)


  Fly     7 NINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDS 71
            |.||.|..: ||.::  ..||:...|..|..||:|.:|:|.|||||.|||:|.||.|:.:.::|.
plant     7 NANPVVQAK-KEGLV--RREDQYRDDGVDPLEIYDYVRDIRDPEHPYTLEQLRVVSEESVTVDDK 68

  Fly    72 QNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVA 136
            .:.:.|:|||||.|||||.:|||.:|.||...|...:||.:.::||:||.|::|||||.|||||.
plant    69 LDRILITFTPTIQHCSMANIIGLCLRAKLKECLQLHYKVDIRVSPGSHADEVSVNKQLNDKERVV 133

  Fly   137 AALENNHLAEVINQCI 152
            |||||.:|.:::::||
plant   134 AALENPNLRQLVDECI 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 71/147 (48%)
AT3G50845NP_001078267.1 DUF59 <29..149 CDD:294611 62/120 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1492
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoInspector 1 1.000 T124220
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 O PTHR12377
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.