DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and ciao2b

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001002449.1 Gene:ciao2b ZFINID:ZDB-GENE-040718-148 Length:159 Species:Danio rerio

Alignment Length:154 Identity:106/155 (68%)
Similarity:132/155 (85%) Gaps:0/155 (0%)


  Fly     3 TEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR 67
            |.:||.||.::.|..||:||:.:|||:|.||.|.||||||||:||||||||:||||:||::..:.
Zfish     5 TRLENANPLIFQRSGERLLTSTDEDEDVADPIDVREIFDLIRSINDPEHPLSLEELNVVEQVRVN 69

  Fly    68 INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADK 132
            :||.:::|.:.||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||
Zfish    70 VNDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPDRFKIDVHITPGTHASEDAVNKQLADK 134

  Fly   133 ERVAAALENNHLAEVINQCIAAKG 156
            |||||||||:.|.||:|||::::|
Zfish   135 ERVAAALENSQLLEVVNQCLSSRG 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 105/151 (70%)
ciao2bNP_001002449.1 DUF59 5..156 CDD:294611 105/151 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21341361
eggNOG 1 0.900 E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6115
Inparanoid 1 1.050 223 1.000 Inparanoid score I3443
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T1054095
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1897
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.