DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and ciao2b

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001002449.1 Gene:ciao2b / 436722 ZFINID:ZDB-GENE-040718-148 Length:159 Species:Danio rerio


Alignment Length:154 Identity:106/154 - (68%)
Similarity:132/154 - (85%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR 67
            |.:||.||.::.|..||:||:.:|||:|.||.|.||||||||:||||||||:||||:||::..:.
Zfish     5 TRLENANPLIFQRSGERLLTSTDEDEDVADPIDVREIFDLIRSINDPEHPLSLEELNVVEQVRVN 69

  Fly    68 INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADK 132
            :||.:::|.:.||||||||||||||||||:||||||||.|||:.|.|||||||||.|||||||||
Zfish    70 VNDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPDRFKIDVHITPGTHASEDAVNKQLADK 134

  Fly   133 ERVAAALENNHLAEVINQCIAAKG 156
            |||||||||:.|.||:|||::::|
Zfish   135 ERVAAALENSQLLEVVNQCLSSRG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 105/150 (70%)
ciao2bNP_001002449.1 DUF59 5..156 CDD:294611 105/150 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590627
Domainoid 1 1.000 109 1.000 Domainoid score I6345
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 215 1.000 Inparanoid score I3601
OMA 1 1.010 - - QHG54279
OrthoDB 1 1.010 - - D1408004at2759
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto38598
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.