DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and Ciao2a

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001008328.1 Gene:Ciao2a RGDID:1307481 Length:160 Species:Rattus norvegicus

Alignment Length:118 Identity:65/119 (55%)
Similarity:86/119 (72%) Gaps:3/119 (3%)


  Fly    38 EIFDLIRNINDPEHPLTLEELHVVQEDLI---RINDSQNSVHISFTPTIPHCSMATLIGLSIRVK 99
            |::||||.|.|||.|.|||||.||.|..:   .|::....|.|.||||:||||:||||||.:|||
  Rat    39 EVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEISEDDYLVIIKFTPTVPHCSLATLIGLCLRVK 103

  Fly   100 LLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCI 152
            |.|.||.:.|:.:.|:.|||::|..:|||:.||||||||:||.:|.|::.||:
  Rat   104 LQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCV 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 65/119 (55%)
Ciao2aNP_001008328.1 DUF59 <39..156 CDD:294611 65/117 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5133
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.