DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and SPAC144.16

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_594677.1 Gene:SPAC144.16 PomBaseID:SPAC144.16 Length:179 Species:Schizosaccharomyces pombe

Alignment Length:178 Identity:89/179 (50%)
Similarity:109/179 (61%) Gaps:27/179 (15%)


  Fly     1 MPTEIENINPNVYD------RIKE----------RVLTANE-EDENVP---DPFDKREIFDLIRN 45
            |...::|.||.|.:      |::|          :.||..| |..|:.   ||.|.:||:||:..
pombe     1 MSANLQNENPEVKELNQLPSRVEEEEDLLLSSTKQWLTEIESEQTNIKEERDPIDPQEIYDLLAK 65

  Fly    46 INDPEHPLTLEELHVVQEDLIRI-----NDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLP 105
            ||||||||||.:|.||:.:.|.:     .||..:|||  |||||||||.|||||.|||:|.|.||
pombe    66 INDPEHPLTLAQLSVVKLEDIEVVDNVEGDSYITVHI--TPTIPHCSMCTLIGLCIRVRLERCLP 128

  Fly   106 PRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCIA 153
            |||.|.|::..||||||..|||||.||||||||.||..|..|:|..:|
pombe   129 PRFHVDVKVKKGTHASESQVNKQLNDKERVAAACENEQLLSVLNGMMA 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 89/179 (50%)
SPAC144.16NP_594677.1 COG5133 2..179 CDD:227462 88/178 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 144 1.000 Inparanoid score I1317
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T1125641
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1897
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.