DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galla-2 and SPAC144.16

DIOPT Version :9

Sequence 1:NP_648416.1 Gene:galla-2 / 39221 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_594677.1 Gene:SPAC144.16 / 2542897 PomBaseID:SPAC144.16 Length:179 Species:Schizosaccharomyces pombe


Alignment Length:178 Identity:89/178 - (50%)
Similarity:109/178 - (61%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPTEIENINPNVYD------RIKE----------RVLTANE-EDENVP---DPFDKREIFDLIRN 45
            |...::|.||.|.:      |::|          :.||..| |..|:.   ||.|.:||:||:..
pombe     1 MSANLQNENPEVKELNQLPSRVEEEEDLLLSSTKQWLTEIESEQTNIKEERDPIDPQEIYDLLAK 65

  Fly    46 INDPEHPLTLEELHVVQEDLIRI-----NDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLP 105
            ||||||||||.:|.||:.:.|.:     .||..:|||  |||||||||.|||||.|||:|.|.||
pombe    66 INDPEHPLTLAQLSVVKLEDIEVVDNVEGDSYITVHI--TPTIPHCSMCTLIGLCIRVRLERCLP 128

  Fly   106 PRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCIA 153
            |||.|.|::..||||||..|||||.||||||||.||..|..|:|..:|
pombe   129 PRFHVDVKVKKGTHASESQVNKQLNDKERVAAACENEQLLSVLNGMMA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 89/178 (50%)
SPAC144.16NP_594677.1 COG5133 2..179 CDD:227462 88/177 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2059
eggNOG 1 0.900 - - E1_COG5133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6115
Inparanoid 1 1.050 144 1.000 Inparanoid score I1339
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001710
OrthoInspector 1 1.000 - - oto101653
orthoMCL 1 0.900 - - OOG6_102398
Panther 1 1.100 - - LDO PTHR12377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1897
SonicParanoid 1 1.000 - - X2577
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.