DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and galla-1

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001286642.1 Gene:galla-1 FlyBaseID:FBgn0034543 Length:218 Species:Drosophila melanogaster

Alignment Length:118 Identity:61/119 (51%)
Similarity:80/119 (67%) Gaps:4/119 (3%)


  Fly    39 IFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQNS----VHISFTPTIPHCSMATLIGLSIRVK 99
            |:||:|.|.|||.|.|||:|:||.||.|.:.....|    |.|.|.||:||||:||||||.||||
  Fly    97 IYDLLRGIRDPEKPCTLEDLNVVYEDGIFVMPPTRSNVSVVRIEFNPTVPHCSLATLIGLCIRVK 161

  Fly   100 LLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCI 152
            :.|.||...|:.:.|..|.|.:|..:|||:.||||:|||:||.:|.:::..||
  Fly   162 VERGLPHNIKLDIYIKKGAHQTEEEINKQINDKERIAAAMENPNLRDLVENCI 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 61/119 (51%)
galla-1NP_001286642.1 DUF59 <94..214 CDD:294611 60/117 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21433419
eggNOG 1 0.900 E1_COG5133
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12377
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.