DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: galla-2 and F45G2.10

Sequence 1:NP_648416.1 Gene:galla-2 FlyBaseID:FBgn0036107 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_499777.1 Gene:F45G2.10 WormBaseID:WBGene00009736 Length:160 Species:Caenorhabditis elegans

Alignment Length:151 Identity:91/152 (60%)
Similarity:122/152 (80%) Gaps:3/152 (2%)


  Fly     5 IENINPNVYD-RIKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIR- 67
            ::|.||.::| :.:.|.:|..|.||:|.||.|..|||||||:|||||||.|||:|:||||:||: 
 Worm     6 LDNANPTLFDSKPRHRPVTGTERDESVEDPIDSWEIFDLIRDINDPEHPYTLEQLNVVQEELIKV 70

  Fly    68 -INDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLAD 131
             |::.:..|.::||||||||||||||||:|||||||||.|:.||:|.||||:|::|.::|:||||
 Worm    71 FIDEEETFVKVNFTPTIPHCSMATLIGLAIRVKLLRSLHPKVKVSVSITPGSHSTEESINRQLAD 135

  Fly   132 KERVAAALENNHLAEVINQCI 152
            |||||||:||..|...:|:|:
 Worm   136 KERVAAAMENQGLMHAVNECL 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
galla-2NP_648416.1 DUF59 1..154 CDD:294611 91/152 (60%)
F45G2.10NP_499777.1 DUF59 <34..156 CDD:294611 81/122 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21342333
eggNOG 1 0.900 E1_COG5133
Hieranoid 1 1.000
Homologene 1 1.000 H6115
Inparanoid 1 1.050 188 1.000 Inparanoid score I2554
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1408004at2759
OrthoFinder 1 1.000 FOG0001517
OrthoInspector 1 1.000 T475836
orthoMCL 1 0.900 OOG5_127914
Panther 1 1.100 LDO PTHR12377
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1897
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.