DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hay and ercc3

Sequence 1:NP_001137931.1 Gene:hay FlyBaseID:FBgn0001179 Length:798 Species:Drosophila melanogaster
Sequence 2:NP_001123812.1 Gene:ercc3 XenbaseID:XB-GENE-1009820 Length:786 Species:Xenopus tropicalis

Alignment Length:806 Identity:553/807 (69%)
Similarity:650/807 (81%) Gaps:30/807 (4%)


  Fly     1 MGPPKKSRKDRSGGDKFGKKRRAEDEAFTQLVDDNDSLDATE-SEGIPGAASKNAETNDEQINTD 64
            ||  |:.:.||....|| |:|..|:|.     ::.:.:...| .|.:|.||.|  :.::.....|
 Frog     1 MG--KRDKADRGDKKKF-KRRHYEEED-----EEEEEVPGGEYQEAVPSAAGK--QVDEAGTKQD 55

  Fly    65 EYGAKDYRSQMQLRPDHGNRPLWVAPNGHVFLESFSPVYKHAHDFLIAISEPVCRPEHIHEYKLT 129
            ||||||||.||.|:.||.:|||||||:||:|||:||||||:|.|||:|||||||||.|.||||||
 Frog    56 EYGAKDYRLQMPLKMDHSSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAISEPVCRPSHTHEYKLT 120

  Fly   130 AYSLYAAVSVGLQTHDIVEYLKRLSKTSIPEGILEFIRLCTLSYGKVKLVLKHNKYFIESPHPEV 194
            ||||||||||||||.||||||::||||.:||||::||:|||:||||||||||||:||:||.||||
 Frog   121 AYSLYAAVSVGLQTSDIVEYLQKLSKTGVPEGIVQFIKLCTVSYGKVKLVLKHNRYFVESTHPEV 185

  Fly   195 LQKLLKDPVIQKCRLIRSEGE--DFIQGT-LDGKAITQFGTKLPPGATDKPTPDPAAAAGADGTT 256
            :|:||:|.||:.|||..:||.  |.|..| |...||::.......|.:....|:     |.|.|.
 Frog   186 IQELLQDSVIRGCRLRDAEGNETDLITETFLSKSAISKASETAASGPSTSQVPE-----GQDKTN 245

  Fly   257 AVPEDITDFYEKIDKEEEDEDEANLKTVSFEVAQEKIEVIQKRCIEIEHPLLAEYDFRNDTNNPD 321
             ||.|:.:|||::|||||:|:|.  :||||||.|:.||.:||:||.:|:||||||||||||.|||
 Frog   246 -VPADLFEFYEQMDKEEEEEEET--QTVSFEVKQDNIEELQKQCIHLEYPLLAEYDFRNDTMNPD 307

  Fly   322 INIDLKPAAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTACCTVRKRALVLCNSGVS 386
            |||||||.||||||||||||||||||||||||||||||||||||||||.||||||.|||.||.||
 Frog   308 INIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVS 372

  Fly   387 VEQWKQQFKMWSTADDSMICRFTSEAKDKPMGCGILVTTYSMITHTQKRSWEAEQTMRWLQEQEW 451
            |||||.|||||||.|||.||||||:|||||:||.|.::||||:.||.|||||||:.|.||:.|||
 Frog   373 VEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSIAISTYSMLGHTTKRSWEAERVMEWLKSQEW 437

  Fly   452 GIMVLDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKKG 516
            |:|:||||||||||||||||||||:||||||||||:||||||.|||||||||||||||:|||..|
 Frog   438 GLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNG 502

  Fly   517 YIARVQCAEVWCPMSPEFYREYLTTKTSKKMLLYVMNPSKFRSCQFLIKYHEQRGDKTIVFSDNV 581
            |||:||||||||||||||||||:..||.|::|||.|||:|||:||||||:||:|.||.|||:|||
 Frog   503 YIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNV 567

  Fly   582 FALKHYAIKMNKPFIYGPTSQNERIQILQNFKFNSKVNTIFVSKVADTSFDLPEANVLIQISSHG 646
            ||||.|||:::||:|||||||.||:.||||||.|.|:||||:|||.|||||||||||||||||||
 Frog   568 FALKEYAIRLSKPYIYGPTSQGERMHILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHG 632

  Fly   647 GSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTMEMSYSRKRQRFLVNQGYSYKVITHLKG 711
            ||||||||||||:||||||.:|||||||||:||||||.||:||.|||||||:||||:||||.|.|
 Frog   633 GSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAG 697

  Fly   712 MDTDSDLMYGTQEEQGQLLQLVLSASDLDCEDEKLPGEPGYRPSGSGGAVRRVGGLSSMSGGDDA 776
            |: :..|.:..:|:|.||||.||:|||||.|:|.:.||.|.|.:..  ..||||.:|||||.|||
 Frog   698 ME-EEHLAFSNKEDQQQLLQKVLAASDLDAEEEVVVGEFGSRSTMQ--VSRRVGTMSSMSGADDA 759

  Fly   777 IYYE-HRKKNIGS----VHPLFKKFR 797
            :|.| |..:|.|:    ||||||:||
 Frog   760 VYMEYHTSRNRGASNKHVHPLFKRFR 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hayNP_001137931.1 rad25 70..795 CDD:273168 528/733 (72%)
Helicase_C_3 86..208 CDD:290354 96/122 (79%)
ResIII 331..488 CDD:282678 132/157 (84%)
ERCC3_RAD25_C 512..756 CDD:292820 180/244 (74%)
ercc3NP_001123812.1 rad25 61..783 CDD:273168 528/733 (72%)
Helicase_C_3 77..199 CDD:290354 96/122 (79%)
ResIII 317..474 CDD:282678 132/157 (84%)
ERCC3_RAD25_C 498..739 CDD:292820 180/242 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H96
Inparanoid 1 1.050 1088 1.000 Inparanoid score I221
OMA 1 1.010
OrthoDB 1 1.010 D100698at2759
OrthoFinder 1 1.000 FOG0004023
OrthoInspector 1 1.000 T600893
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R402
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.