DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARHGAP1 and RhoGAP68F

Sequence 1:NP_004299.1 Gene:ARHGAP1 HGNCID:673 Length:439 Species:Homo sapiens
Sequence 2:NP_001261744.1 Gene:RhoGAP68F FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster

Alignment Length:460 Identity:168/461 (36%)
Similarity:250/461 (54%) Gaps:57/461 (12%)


Human     4 LSELQD---DLTLDDTSEALNQLKLASIDEKNWPSDEM-PDFPKSDDSKSSSPELVTHLKWDDPY 64
            ||:|.|   .|..|||     :|...|..||    |.| .||..::|.:....|.|..|  :|.:
  Fly    30 LSDLHDFEPKLEFDDT-----ELLAPSPLEK----DVMVGDFVLAEDPELEPEEDVNPL--EDDF 83

Human    65 YDIARHQI---------VEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKH---TLDQYVE 117
            .|..|.|.         .:..|.||.||.|....|.|.|...||:     |:::.   .::.:||
  Fly    84 EDQLREQSENFQTPRNKCDFLGTDKQGRHIFGIYASRFPEKSQLE-----GFVREIIKEIEPFVE 143

Human   118 SDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKF 182
            :||.|:|.|.||..|||||..:|.::|:|.||.::||:|.||:||||.||:.:...|.|.||.||
  Fly   144 NDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKF 208

Human   183 GQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPN-------- 239
            .:|:.|::.|.||.:.:.|.:|.:|..:...||.|..::       ||..| ||..|        
  Fly   209 RKKLVYISSLDELRQALGLNKLKLPDNICDLDDKLNPSR-------KPSTP-PPSSNINASRQQQ 265

Human   240 ------QQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQ-AHALTTEGIFRRSANTQVVREVQQKY 297
                  .||||.|:.:...:|....||.::|:.|..|. ...:.||||||||.|...:..::::.
  Fly   266 HKMATTHQFGVPLKFIVMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERV 330

Human   298 NMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVL-QTLP 361
            |.|..||....| :|:.|.:||:|||:|.||||||:||..|.|||:..:.:|.....|:: :.||
  Fly   331 NRGEDVDLKSVN-VHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLP 394

Human   362 EENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDH 426
            ||||::.:::..|||::....|.||||::|||:|||||.||::..:.:|:.|.|||.|..|:|.:
  Fly   395 EENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQN 459

Human   427 QGELF 431
            ..:::
  Fly   460 HKDIY 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARHGAP1NP_004299.1 CRAL_TRIO_2 82..206 CDD:290435 52/127 (41%)
SH3-binding 228..238 5/10 (50%)
RhoGAP-p50rhoGAP 239..431 CDD:239869 80/208 (38%)
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 55/133 (41%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 79/196 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2358297
eggNOG 1 0.900 E1_KOG4406
Hieranoid 1 1.000
Homologene 1 1.000 H20909
Inparanoid 1 1.050 260 1.000 Inparanoid score I3072
Isobase 1 0.950 0 Normalized mean entropy S2980
OMA 1 1.010
OrthoDB 1 1.010 D1511935at2759
OrthoFinder 1 1.000 FOG0001242
OrthoInspector 1 1.000 T610083
orthoMCL 1 0.900 OOG5_130776
Panther 1 1.100 LDO PTHR45808
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4738
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.