DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbfox1 and Rbfox1

Sequence 1:NP_001246707.1 Gene:Rbfox1 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster
Sequence 2:XP_017452692.1 Gene:Rbfox1 RGDID:1311210 Length:563 Species:Rattus norvegicus

Alignment Length:413 Identity:142/414 (34%)
Similarity:172/414 (42%) Gaps:137/414 (33%)


  Fly   282 GGTPSSPLSNSPSSATASQAGGCG----LTLNGSATEGSMSGDTSPVASGEPLLQTPPAHQQQQQ 342
            |.|...| :.......|:|.||.|    |:|..|..|..             :|.:||..|.::.
  Rat    47 GATTPRP-ARDERDELATQTGGEGRSEQLSLPPSLVESQ-------------VLVSPPVDQAEET 97

  Fly   343 QQQP------------------LLCSSPTS----------MQSSGTSVTG---SSIASGTLAATS 376
            .|:|                  ..||:...          |......:.|   ::.|..|:|...
  Rat    98 AQRPHESGTYGFLDQAQHSDIKADCSNCVETEDRKVLRQPMNCEREQLRGNQEAAAAPDTMAQPY 162

  Fly   377 SSGVGLLPTTGLDSIANGGAP------TGCAVVPASTSQVIAHLNAAAAAASGIVSPSANVATSL 435
            :|.....|..|:.:......|      ||...||..|      ||        :..|:.  ..|.
  Rat   163 ASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPDHT------LN--------LYPPTQ--THSE 211

  Fly   436 SSALVPAQSVAAVAAASLDA-----------------KSQPKRLHVSNIPFRFRDPDLRAMFGQF 483
            .||...||:|:..|..:.||                 ||||||||||||||||||||||.|||||
  Rat   212 QSADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLHVSNIPFRFRDPDLRQMFGQF 276

  Fly   484 GTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVP- 547
            |.|||||||||||||||||||||.||.||:||||:||||||||||||||||||||.|.|....| 
  Rat   277 GKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKAVNPY 341

  Fly   548 ----------------------------------------NVVLTKDGAIPAPALVCVQWPEAAV 572
                                                    ::|.|...::|.|..   .:|.|..
  Rat   342 TNGWKLNPVVGAVYSPDFYAGTVLLCQANQEGSSMYSGPSSLVYTSANSVPVPGF---PYPAATA 403

  Fly   573 AAAMRGVAIQRGHVGVVGATPYH 595
            |||.||..: ||.    |.|.|:
  Rat   404 AAAYRGAHL-RGR----GRTVYN 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 80/105 (76%)
RRM_FOX1_like 460..535 CDD:240853 69/75 (92%)
Rbfox1XP_017452692.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113739365
eggNOG 1 0.900 E1_KOG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3596
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000844
OrthoInspector 1 1.000 T617535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15597
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.