DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbfox1 and fox-1

Sequence 1:NP_001246707.1 Gene:Rbfox1 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_001317857.1 Gene:fox-1 WormBaseID:WBGene00001484 Length:429 Species:Caenorhabditis elegans

Alignment Length:574 Identity:168/575 (29%)
Similarity:216/575 (38%) Gaps:199/575 (35%)


  Fly   294 SSATASQAGGCG-LTLNG-----------SATEGSMSGDTSPVASGEPLL-QTPPAHQQ--QQQQ 343
            |:||.:....|. :.:|.           |||.........|:.....|| |...||||  .||.
 Worm     9 STATHASLNACDPIVVNSEALPMQALYQLSATGAQQQNQQIPIGLSNSLLYQQLAAHQQIAAQQH 73

  Fly   344 QQPLLCSSPTSMQSSGTSVTGSSIASGTLAATSSSGVGLLPTTGLDSIANGGA---PTGCAVVPA 405
            ||.|..|:....|::            .:.|||:..:    ...:::..:|..   |.....:..
 Worm    74 QQQLAVSAAHQTQNN------------IMLATSAPSL----INHMENSTDGKVKDDPNSDYDLQL 122

  Fly   406 STSQVIAHLNAAAAAASGIVSPSANVATSLSSALV--PAQSVAAVAAASLDAKSQ---------- 458
            |..|.:|  .||.||..|        .|.:...:|  ..|.|.|..|.|.:..:.          
 Worm   123 SIQQQLA--AAAQAAQMG--------QTQIGPQIVGQQGQPVVATTAGSTNGSAAVTQPDPSTSS 177

  Fly   459 ----PKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERL 519
                ||||||||||||||||||:.||.:||.:.||||||||||||||||||.....||||||:.|
 Worm   178 GPDGPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQEL 242

  Fly   520 HGTVVEGRKIEVNNATARVQTKKVTAVPNVVLTKDGAIPAPALVCVQWPEAAVAAAMRGVAIQRG 584
            ||:::||||||||.|||||.:|||.                       |...:...|.       
 Worm   243 HGSMIEGRKIEVNCATARVHSKKVK-----------------------PTGGILDQMN------- 277

  Fly   585 HVGVVGATPYHHPHHPHHHPALLAASAAAAQQQQQRQLAAAAVATAAVAQQQQQQQQAVVQQQQQ 649
                                .|:|.||.|||.|..|   |..:.:..|||....:..|::..   
 Worm   278 --------------------PLMAQSALAAQAQMNR---ALLLRSPLVAQSLLGRGAALIPG--- 316

  Fly   650 QVAAAAQQQHQQQQQQQQQAVQQQQAVQQQQQHQQQQQQQQQQQHAAVAAAAAAASHPHMHAAHA 714
                                 .||.|.|.|                     ||.|.:|       
 Worm   317 ---------------------MQQPAFQLQ---------------------AALAGNP------- 332

  Fly   715 HAHAHALGPQLAQLQAVAVPTAASNAAALQQSLAAAIQNPSGNPNAAAAAAAYAARLSAATGATQ 779
                      |||||...:   ..||||||.:   |:|..:...:.||..||..|.       .|
 Worm   333 ----------LAQLQGQPL---LFNAAALQTN---ALQQSAFGMDPAAVQAALLAN-------EQ 374

  Fly   780 SPQTAAAAAAAASMAASANAANNAAALHGFAPVYYDPFLAAAA----SADPNLR 829
            :....|||||...:.:|.||:       .|...|....||.|:    ..:|.||
 Worm   375 ARFQLAAAAAQGRIPSSGNAS-------AFGEQYLSNALATASLPSYQMNPALR 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 63/102 (62%)
RRM_FOX1_like 460..535 CDD:240853 57/75 (76%)
fox-1NP_001317857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134120956
eggNOG 1 0.900 E1_KOG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000844
OrthoInspector 1 1.000 T374855
orthoMCL 1 0.900 OOG5_135623
Panther 1 1.100 LDO PTHR15597
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2530
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.