DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rbfox1 and asd-1

Sequence 1:NP_001246707.1 Gene:Rbfox1 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_497841.1 Gene:asd-1 WormBaseID:WBGene00011279 Length:404 Species:Caenorhabditis elegans

Alignment Length:464 Identity:151/465 (32%)
Similarity:195/465 (42%) Gaps:121/465 (26%)


  Fly   405 ASTSQVIAHLNAAAAA-------ASGIVSPSANVATSLSSAL------VPAQ-------SVAAVA 449
            |...|::|..|.||||       .|...:|.:..:...:..|      .|.|       ::..||
 Worm    21 ALQQQMVAAQNGAAAAVLRPHQIGSSPEAPQSQTSGGSTEQLQQQPLPPPTQQKQQQPLTIGPVA 85

  Fly   450 ----AASLDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSN 510
                :.|..:...|:|||||||||::|:|||.|||.:.|.::||||||||||||||||||..|.:
 Worm    86 PNDRSTSSSSTDGPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPD 150

  Fly   511 DAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVVLTKDGAIPAPALVCVQWPEAAVAAA 575
            ||:|||...:||.:|||::|||.||.||..||...:.:                           
 Worm   151 DADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMS--------------------------- 188

  Fly   576 MRGVAIQRGHVGVVGATPYHHPHHPHHHPALLAASAAAAQQQQQRQLAAAAVATAAVAQQQQQQQ 640
                      |||               .|:.|.:|..:||||        :..||:.|||...|
 Worm   189 ----------VGV---------------DAMSAQNALISQQQQ--------IQRAALLQQQLLAQ 220

  Fly   641 QAVVQQQQQ------QVAAAAQQQHQQQQQQQQQAVQQQQAVQQQQQHQQQQQQQQQQQHAAVAA 699
            |.:|.:.||      ..||.:|.|..|.||....|.||||.:|..|.....|||||.|..|...:
 Worm   221 QFLVPRHQQLMMPPTSAAAISQLQALQYQQALLAAQQQQQQMQNPQFLLSLQQQQQAQAQAPPTS 285

  Fly   700 AAAAASHPHMHAAHAHAHAHALGPQLAQLQAVAVPTAASNAAALQQSLAAAIQNPSGNPNAAAAA 764
            .|....|....|....|.|.|   |.||.|.|.:  .|.....:|...|||.....|.|.     
 Worm   286 MAQLIQHQQQFAMDPMAQAQA---QAAQAQMVTL--IAFEQQRMQLQAAAAAAQGRGVPQ----- 340

  Fly   765 AAYAARLSAATGATQSPQTAAAAAAAASM--------AASANAANNAAALHGFAPVYYDPFLAAA 821
               ..|:..:|..|.|.|...||.:....        |..||..:::.|||.          |||
 Worm   341 ---PGRIPTSTATTGSSQNQVAAGSIGEQYLQQSMQGAVPANFHHHSQALHP----------AAA 392

  Fly   822 ASADPNLRF 830
            |:|....||
 Worm   393 AAAALQRRF 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 55/88 (63%)
RRM_FOX1_like 460..535 CDD:240853 50/75 (67%)
asd-1NP_497841.1 RRM <99..>185 CDD:223796 56/86 (65%)
RRM_FOX1_like 100..175 CDD:240853 50/75 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374855
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15597
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2530
TreeFam 1 0.960
54.990

Return to query results.
Submit another query.