DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir7f

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster

Alignment Length:623 Identity:125/624 (20%)
Similarity:195/624 (31%) Gaps:265/624 (42%)


  Fly    15 LEGNRLVQTVQELNNIYQTELNVFLEFGNGADILESAQ----GTFVPTLWIKN---PQNQKVMKG 72
            |..|.::||.       |.|:.|:..:...||..:.|.    .||....|..:   |.....|.|
  Fly   169 LHCNVMIQTA-------QVEVLVYTYYPYTADACQKAYPIPVNTFDGRKWKASQMFPDKLSQMHG 226

  Fly    73 NFTSCTLTILYLEDEHLDRGLYYLANW--------LWEYHHLEVLIFFNGGSYD-KLIQIFSRCF 128
                |.||:|               .|        :|:..|..    ..|..:: :|::..:|..
  Fly   227 ----CPLTVL---------------TWHQPPFVELVWDPKHNR----SRGSGFEIQLVEHLARRM 268

  Fly   129 NEG--FVNVLVMLP-------GSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGL 184
            |..  .||:.::.|       ||.|    .|.:.|...|:                   ||:.| 
  Fly   269 NFSLELVNIALLRPNAYRLAEGSSE----GPIEKLLQRNV-------------------NISMG- 309

  Fly   185 VIAGAPRWFSFRDRQNRLILT--GYMLRMIVDFTNHFNGSVRLMNVLTVN----DGLELLANRTI 243
                   :|....|:|:|:.|  .|.             |..|:.||.:.    ..|.||.    
  Fly   310 -------YFRKTARRNQLLTTPMSYY-------------SANLVAVLQLERYRIGSLALLV---- 350

  Fly   244 DFFPFLIRPLKSFSMSNILYLENCGLIVPTSR-----------------------PLP-NWVYLL 284
              |||   .|..:.:..:..|.:.|:.:|::|                       .|| :|.:  
  Fly   351 --FPF---ELSVWMLLLLALLIHLGIHLPSARRGNEEDGGGGLQVVALLLGAALARLPRSWRH-- 408

  Fly   285 RPYAFDTWIA--WLIMLIYCSLALRILSKGQISISAAFLKVLRLVMY-----------LSGSRDM 336
                  .:||  ||    :.|:.||      ||..:....::||.:|           ..|.:.:
  Fly   409 ------RFIAAHWL----WASIPLR------ISYQSLLFHLIRLQLYNTPSFSLDQLLAEGFQGI 457

  Fly   337 GTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKT 401
            .|..|.|.|               |.:.||:               .|.|...|:....|.|:  
  Fly   458 CTANTQRLL---------------LEMPQLA---------------RDPDSIQSVDTPFDWDV-- 490

  Fly   402 MEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLL 466
            :..|..:|.   :||......||       ..|.:||        :.:...|          |::
  Fly   491 LNVLTRNRN---RKIFAVANQDV-------TLSFLHS--------SAHPNAF----------HVV 527

  Fly   467 YQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFR-------DRHL 524
             :||:.:..|         ..::.|  .|.:|.||.||..|.. .||.:: |:|       .|..
  Fly   528 -KQPVNVEYA---------GMYMPK--HSFLYEKMDDDIRRLD-ASGFIH-AWRRASFASVHRKE 578

  Fly   525 EVKSNDVEY---------------YYLIAGLWFGGLTL 547
            :|......|               .||:|||.|.|..|
  Fly   579 QVHMTSRRYINHAKLSGIYMVMAGLYLLAGLLFAGEVL 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 37/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.