DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir7e

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001138176.1 Gene:Ir7e FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster

Alignment Length:529 Identity:106/530 (20%)
Similarity:188/530 (35%) Gaps:141/530 (27%)


  Fly    94 YYLANWLWEYHHLEVLIFFNGGSYDKLIQ-----IFSRCFNEGFVNVLVMLPGSDE---LYTFMP 150
            ||...:.:..|:   .||..  :.|:|:|     ||..|:....::..:.:..|:.   .|::.|
  Fly   113 YYSREYNYNEHY---FIFLQ--ARDRLLQGEMRLIFDYCWRYRLIHCSIQVQKSNGDILFYSYYP 172

  Fly   151 Y----------QDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQNRLILT 205
            :          |.:...|...:.|.....||..:..|..:...|  ...|.:.:..:.|..::..
  Fly   173 FGEHGCSDMEPQLINRYNGSMLVEPDLFPRKLRNFFGCPLRCAL--WDVPPFLTLDEDQEEVLRV 235

  Fly   206 --GYMLRMIVDFTN--HFNGSVRLMNVLTVNDGLELLANRTIDFF-----PFLIRPLKSFSMSNI 261
              ||..|:::....  :|..:||.::|...::.||:|....:|..     ..:.|.:.:.|..|.
  Fly   236 NGGYEGRLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNY 300

  Fly   262 LYLENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSKGQISISAAF-LKVLR 325
            ........::.:|..|.::..|..||....|:..|               |.:::||.. |.|.|
  Fly   301 HQTREVFGVLASSYELSSFDILFYPYRLQIWMGIL---------------GVVALSALIQLIVGR 350

  Fly   326 LVMYLSGSR--------DMG------TRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYE 376
            ::....|||        .:|      .|..|.||:. |:|.....|:..:|         .||..
  Fly   351 MLRERMGSRFWLNLELVFVGMPLLECPRSHTARLYC-VMLMMYTLIIRTIY---------QGLLY 405

  Fly   377 KQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDR-TKLLKKIVPTLEADVDTYRRNLNTSCIHSGF 440
            ..|.| ..|::    ||      :|:|.|:... |.:|..||..:..::.:.:            
  Fly   406 HLIRT-HQLNR----WP------QTIESLVQKNFTVVLTPIVQEVLDEIPSVQ------------ 447

  Fly   441 FDRIDFALYQQKFLRFPI-FRKFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDD 504
              .:.|.|.:......|: |.:..|.| :|.:..||      |.:|..|.|         ...|.
  Fly   448 --HMRFRLLEANSELDPLYFLEANHQL-RQHVTASA------LDIFIHFNR---------LSADK 494

  Fly   505 AYRHGIQ-SGLLNLAFRDRHLEVKSNDV----------EYYYLIAGL-----WFGGLTLATVCFL 553
            .::.|.| ||        .|.|:...|:          ::.:||..|     |...:.|.:|...
  Fly   495 VHQRGEQGSG--------AHFEIVPEDIISMQLTMYLAKHSFLIDQLNEEIMWMRSVGLLSVWSR 551

  Fly   554 LELLIGYAK 562
            .||...|.:
  Fly   552 WELSESYLR 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 16/95 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.