DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir94d

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001138099.1 Gene:Ir94d FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster

Alignment Length:603 Identity:118/604 (20%)
Similarity:236/604 (39%) Gaps:131/604 (22%)


  Fly    21 VQTVQELNNIYQTELNVFLEFG-NGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCTLTILYL 84
            ::.|..|.|...|.|::..:.. :...|.|.::.|:   ..::||.:.          .|||.::
  Fly    35 IEYVLLLGNFDTTWLDILWQLPVSVLQIKEHSRETY---SLLENPSHN----------VLTIAFV 86

  Fly    85 ED------EHLDRGLYY-------------------LANWLWEYHHLEVLIFFNGGSYDKLIQIF 124
            .|      |.|.|.|..                   |..|.|.:..|:|:               
  Fly    87 NDSPEDILEILYRNLRMLNTQPVLLVIRKSTIRVNSLLEWCWHHQLLKVV--------------- 136

  Fly   125 SRCFNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAG- 188
              ...:.|:..|:       :|::.|:..|:.:..:.........::..:|:||.:.  :.:.| 
  Fly   137 --AIAQDFMESLI-------VYSYNPFPVLQFIERRLDNSTVIFEKRLENLHGYEVP--IALGGS 190

  Fly   189 APRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMN--------VLTVNDGLELLANRTIDF 245
            :||...:||.:.:||.:|.:...:..|...:|  .||:.        :....|.:..:.|.::..
  Fly   191 SPRLIVYRDLEGKLIFSGPVGNFMKSFEQRYN--CRLVQPYPFDESAISPARDLIASVQNGSVQI 253

  Fly   246 FPFLIRPLKSFS-MSNILYLENCGLIVPTSRPLPN---WVYLLRPYAFD-TWIAWLIMLIYCSLA 305
            ....|.|...:: .|..:.|.:..|::|....:|:   :..:..|.||. |.:|.:::.:..|:|
  Fly   254 ALGAIYPQVPYTGYSYPIELMSWCLMMPVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMA 318

  Fly   306 LRILSKGQISISAAFL--KVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSS 368
            || |...::|.|..||  ..||.|:..|....:......:.::|.:.|.  |.::|:.|.:..|:
  Fly   319 LR-LHGYRVSFSEYFLHDSCLRGVLSQSFYEVLRAPALIKAMYLVICLL--GLLITSWYNSYFST 380

  Fly   369 NSAAGLYEKQINTWEDLDKSD---SIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRN 430
            ...:.....|:.::|.:..|:   .||       |...:::...::.::|.....:...| |:..
  Fly   381 FVTSAPRFPQLTSYESIRHSNIKIVIW-------KPEYEMLLFFSENMEKYSSIFQLQED-YKEF 437

  Fly   431 LNTSCIHSGFFDRIDFAL---------YQQKFLRFP---------IFRKFPHLLYQQPLQISAAF 477
            |:   :...|..|..:.:         .||:....|         :|...|.:.   |:..::.|
  Fly   438 LH---LRDSFDTRYGYMMPMEKWSLMKEQQRVFSSPLFSLQDDLCVFHTVPIVF---PMVKNSIF 496

  Fly   478 GRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLE---VKSNDVEYYYLIAG 539
            ..|    |:..:..:..:|:..:.:|.::...|::|.|.|..|....|   :|..|:...:...|
  Fly   497 KEP----FDRLILDVTATGLLSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQIWRFVG 557

  Fly   540 LWFGGLTLATVCFLLELL 557
             |.  |.|||:.|||||:
  Fly   558 -WM--LGLATIVFLLELI 572



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.