DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir100a

DIOPT Version :8

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_651898.2 Gene:Ir100a / 43753 FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster

Alignment Length:663 Identity:130/664 (20%)
Similarity:229/664 (34%) Gaps:183/664 (28%)


  Fly     8 TLQSLSL-LEGNRLVQT------------VQELNNIYQTELNVFLEFGNG---------ADILES 50
            |||.:.| |.|..|.|.            |::|....:..|....:.||.         :.|:.|
  Fly     4 TLQLIMLALVGGTLGQANNTDHKQVLTSIVKQLEGGLELHLRTSEDGGNDLVQFLMQEKSSIIIS 68

  Fly    51 AQGTFVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGG 115
            |:...||:       ..|:|:.:|                    ::.:.:.:...:...:|...|
  Fly    69 AKQEEVPS-------RAKIMRHHF--------------------FIFDGVHQMQEIRTSLFNTDG 106

  Fly   116 SY-----------DKLIQIFSR--CFNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYS 167
            .|           |.|:..|:.  ....|...:..:......:..|.|:    :..|..:::..:
  Fly   107 FYILALENNTIEDDVLLMEFAADVWLQHGHSRIYYVQLSKKSVLLFNPF----LQRLVVVQDSKT 167

  Fly   168 LSRKKMDLNGY--------NITSGLVIAGAPRWFSFRDRQNRLILT-GYMLRMIVDFT---NHFN 220
            .||...||.||        ::.|.::..|..:..|......:|..| ...|....||.   :.|.
  Fly   168 YSRIYKDLEGYHLRIYIFDSVYSSVIGDGENKVLSVTGADAKLAKTVARQLNFTADFVWPDDEFF 232

  Fly   221 GSVRLMNVLTVNDGLELLANRTID--FFPFLIRPLKS--FSMSNILYLENCGLIVPTSRPLPNWV 281
            |. ||.|. ..:.|:.......:|  |..|.|:...:  ...|..:|::...|.|..::.:|..:
  Fly   233 GG-RLANG-EYSGGVGRAHRGEVDIIFAGFFIKDYLTTHIQFSAAVYMDELCLYVKKAQRIPQSI 295

  Fly   282 YLLRPYAFDTWIAWLIMLIYCSLALRILSKGQISISAAFLKVLRLVMYLSGSRDMGTRPT----- 341
            ..|.....|.|:.:|::.:..:|...|            |:.:.|::.:.|..| |:|.|     
  Fly   296 LPLFAVHMDVWLCFLLVGLLGALVWLI------------LRAVNLILGIEGVPD-GSRATRISYF 347

  Fly   342 --TRRLFLFV-------------------ILTTSGFILTNLYVAQLSSNSAA----GLYEKQINT 381
              .||:|:..                   |...|..:::.::.|.|.|:.|.    .||.:.:||
  Fly   348 GAARRIFVDTWVIWVRVNVGRFPPFHSERIFVASLCLVSVIFGALLESSLATVYIRPLYYRDVNT 412

  Fly   382 WEDLDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADV------DTYRRNLNTSCI---- 436
            ..:||:|..     .:.||.                |..:.|:      :.||| |:...:    
  Fly   413 LRELDESGQ-----PIYIKH----------------PAFKDDLFYGHNSEVYRR-LDAKMMLVAE 455

  Fly   437 -----------HSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAF----GRPYLQLFN 486
                       ..||......|..|...:|:.:.:|. |.:.:.|.....|:    ..|||:..|
  Fly   456 GEERLIEMVSKRGGFAGVTRSASLQLSDIRYVMTKKV-HKIPECPKNYHIAYVLPRPSPYLEEVN 519

  Fly   487 WFVRKIFESGI---YLKMKDDAYRHGIQSGLLNLAFRD--RHLEVKSNDVEYYYLIAGLWFGGLT 546
            ..|.::...||   :.....:..:..||.....||..|  |...:..:||:..:.  .|..|.|.
  Fly   520 RIVLRLVAGGIVGLWTGEAKERAKWSIQRFPEYLAELDVGRWKVLTLSDVQLAFY--ALTIGCLL 582

  Fly   547 LATVCFLLELLIG 559
            .|.|| :.|:|:|
  Fly   583 SAIVC-MAEILLG 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 12/47 (26%)
Lig_chan <439..580 CDD:278489 30/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.