DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir94h

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_651148.2 Gene:Ir94h FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster

Alignment Length:577 Identity:113/578 (20%)
Similarity:218/578 (38%) Gaps:131/578 (23%)


  Fly    43 NGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLE 107
            |...|:...:.|: |.|:.::..|..||     :|..:..|      |..|..||..|..|..:.
  Fly    53 NHPQIIWFREETY-PGLYKRHSSNLFVM-----ACLSSTSY------DGQLQLLAESLTRYRSVR 105

  Fly   108 VLIFFNG--GSYDKLIQIFSRCFNEGFVNVLVML---PGSDELYTFMPYQDLKILNLK---SIKE 164
            |||....  ||: ...||...|.....:||::..   ..:..:::::.:...|:|..:   |::.
  Fly   106 VLIEVQDKEGSF-LASQILLLCQQHSMLNVVLYFSRWTRTLNVFSYLAFPYFKLLKQRLSGSLRP 169

  Fly   165 FYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVL 229
            ...:::.| ||.||.|.....:: .|..||:|||.....:.|::.|::.:|:....|..:::   
  Fly   170 KIFINQLK-DLQGYKIRVQPDLS-PPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDTQVL--- 229

  Fly   230 TVNDGLELLANRTIDFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPLPNWVY--LLRPYAFDTW 292
                            :|...:...|.:...|.:..|....:..:..:..:.:  ..|.|::..:
  Fly   230 ----------------YPTWAKAKVSAAEYMIQFTRNGSSDIGVTTTMITFKHEERYRDYSYPMY 278

  Fly   293 -IAWLIML-IYCSLALRILSKGQISISAAFLKVLRLVMYL-------------SGSRDMGTRPTT 342
             |:|..|| :...|::.||....:|..:|.|.:|..:::.             ...|.:|   ..
  Fly   279 DISWCTMLPVEKPLSVEILFSHVLSPGSALLLILAFILFFLIVPQLIKCLGITFRGRLIG---MA 340

  Fly   343 RRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLIP 407
            .|:|..|:|.:|.        |||.|...:.....:|.:::||             :.:..|:..
  Fly   341 SRIFALVMLCSSS--------AQLLSLLMSPPLHTRIKSFDDL-------------LTSGLKIFG 384

  Fly   408 DRTKL----------LKKIVPTLEADVDTY--RRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFR 460
            .|::|          ........|...:.|  |...|||..::....:.:....||:....|:||
  Fly   385 IRSELYFLDGGFRAKYASAFHLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFR 449

  Fly   461 K----------------FPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHG 509
            .                .|...|::|||              .|..||.::|:..:....::...
  Fly   450 YSTDLCFSSETPWGLLIAPESFYREPLQ--------------HFTLKINQAGLITQWMTQSFHEM 500

  Fly   510 IQSGLLNLAFRDRHLEVKS---NDVEYYYLIAGLWFGGLTLATVCFLLELLIGYAKI 563
            :::|.:.:....|...:|.   .|:...::|..:   ||..:||.|.:|||:.|..:
  Fly   501 VRAGRMTIKDYSRTNLMKPLRIQDLRKCWVIFAV---GLGTSTVVFTIELLLIYTNV 554



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.