DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir94g

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster

Alignment Length:593 Identity:109/594 (18%)
Similarity:212/594 (36%) Gaps:121/594 (20%)


  Fly    20 LVQTVQELNNIY---QTELNVFLEFGNGADILESAQGTFVPTLWIKNPQNQKVMKGNFTSCTLTI 81
            |:...|||.:|:   ..:....||     |.:.||.......:|  ......::.|......|.:
  Fly    15 LISRGQELTSIFFYAPAKEKCHLE-----DTISSATWGLPLVIW--RTDRTVILNGFIGEGLLVL 72

  Fly    82 LYLEDEH-------LDRGLYYLANWLWEYHHLEVLIFFNGGSYDKLI-QIFSRCFNEGFVNVLVM 138
            ..|...|       |.|.|.||       ....:||.......:.|: ::...|.::..:||..:
  Fly    73 ACLPGFHWRALLGSLARSLKYL-------RQARILIELMQDRDEFLVSEVLQFCLSQDMINVNAI 130

  Fly   139 ---LPGSDELYTFMPYQDLKILNL-----KSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSF 195
               .|.::.|.:|..|...:::|.     ..:.:.|  ..|.::|.| .:...:.....|....:
  Fly   131 FDDFPETENLSSFEAYPSFEVVNQTFTPDTQVSDLY--PNKMLNLRG-GVIRTMPDYSEPNTILY 192

  Fly   196 RDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLELLANRTIDFFPFL----------- 249
            :|::....:.||:..::..:.:..|..::::|        :...:|.::|...|           
  Fly   193 QDKEGNKEILGYLWDLLEAYAHKHNAQLQVVN--------KYADDRPLNFIELLDAAQSGIIDVG 249

  Fly   250 --IRPLKSFSMS---NILYLEN----CGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLA 305
              |:|:...|:|   .:.|..|    |.:: |..|.|.....|.|...:.|....|::.|     
  Fly   250 ASIQPMSMGSLSRMHEMSYPVNQASWCTML-PVERQLHVSELLTRVIPYPTLALLLLLWI----- 308

  Fly   306 LRILSKGQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFI--LTNLYVAQLS- 367
                          |.:|||      |.....:|..:....:...|.:|.::  |.||:....| 
  Fly   309 --------------FYEVLR------GRWRRHSRLQSIGWLVLATLVSSNYVGKLLNLFTDPPSL 353

  Fly   368 --SNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLI--PDRTKLLKKIVPTLEADVDTYR 428
              .||.|.|.|.               |:..:.|::....|  ..|||........|.|.:....
  Fly   354 PPVNSLAALMES---------------PVRIISIRSEYSAIEFTQRTKYSAAFHLALHASILIGL 403

  Fly   429 RN-LNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQ--PLQISAAFGRPYLQLFNWFVR 490
            || .|||..::...::......|||....|:||....|.:.:  |..:......|:....:.:..
  Fly   404 RNAFNTSYGYTITSEKWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSYTL 468

  Fly   491 KIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKS---NDVEYYYLIAGLWFGGLTLATVCF 552
            .:.::|::....:..:.:.:::|.:|........|.|:   .|:...::|   :...|.::.:.|
  Fly   469 LLRQAGLHDFWVNRGFSYMVKAGKINFTAVGERYEAKTLTITDLRNVFII---YVSVLLISLILF 530

  Fly   553 LLELLIGY 560
            ..||.:.:
  Fly   531 TCELFVSW 538



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.