DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir94e

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001097885.2 Gene:Ir94e FlyBaseID:FBgn0259194 Length:611 Species:Drosophila melanogaster

Alignment Length:635 Identity:135/636 (21%)
Similarity:264/636 (42%) Gaps:120/636 (19%)


  Fly     6 LNTLQSLSLLEGNRLVQTVQELNNIYQTELN---VFL----------EFGNGA----DILESAQG 53
            |:.|..:||:.|    .||.||....:.||:   |.|          :..||.    |:::..| 
  Fly     8 LSGLCLISLVSG----ATVIELLGTLKLELDFEYVLLMKNRNFSLSDQVWNGTSLTKDVMDEVQ- 67

  Fly    54 TFVPTLWIKNPQNQKV---MKGNFTSCTLTILYLEDEHLD--RGLYYLANWLWEYHHLEV--LIF 111
              ||.|..    |:.|   :..:.:...:|:.::.|.:||  |||  |...:....|:..  :||
  Fly    68 --VPVLQF----NENVSYFLHNSISRRLVTLGFMSDANLDEHRGL--LTALVANLRHMTTSRVIF 124

  Fly   112 F--NGGSYDKLIQIFSRCFNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKM- 173
            .  :..|.|.|.::|..|:.:..:||:|:....:...||..|.:..||.::  :..|..|.:.: 
  Fly   125 LVQSKASTDFLYELFRNCWRKKLLNVIVIFQDFETTSTFYSYSNFPILQIE--ERIYETSLQTLP 187

  Fly   174 -------DLNGYNITSGLVIAG-APRWFSFRDRQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLT 230
                   :|:||.:.  :::.| |||..::|:::..::..|.:...:..|...:|  |:.:..|.
  Fly   188 IFPDRLRNLHGYEMP--VILGGTAPRMIAYRNKKGNVVYDGTVGHFMTAFQQKYN--VKFVQPLQ 248

  Fly   231 VNDGLEL---------LANRTIDFFPFLIRP-LKSFSMSNILYLENCGLIVPTSRPLPNWVYLLR 285
            ..:.|:.         :.|.|::....|..| :..|..|......|..:::|....:|.:.|..|
  Fly   249 AKNPLDFAPSMQTVGAVRNETVEISISLTFPTIPPFGFSYPYEQMNWCVMLPVEADVPPFEYYTR 313

  Fly   286 PYAFDTWIAWL--IMLIYCSLALRILSKGQISISAAFL---KVLRLVMYLSGSRDMGTRPTTRRL 345
            .:....::..|  ::||.|.||..:...|..:..:.||   ..||.|:..|...........|.:
  Fly   314 VFELAAFLLTLGTLVLISCLLASALSLHGYATNISEFLLHDSCLRGVLGQSFVEVFRAPTLVRGI 378

  Fly   346 FLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKLI---P 407
            :|.:.:.  |.::|..|.:..||...:...:....|::|:             :.:..|::   |
  Fly   379 YLEICVL--GILITAWYNSYFSSYVTSAPKQPPFRTYDDI-------------LASKLKVVAWKP 428

  Fly   408 DRTKLLKKIVP--------TLEADVDTY---RRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRK 461
            :..:|:.:::.        .:|.|.:.|   |..|:|...:....:|......|||....|:|:|
  Fly   429 EYAELVGRLLEFRKYETMFLVEPDFNRYLALRDTLDTRYGYMITTNRWVLINEQQKVFSRPLFQK 493

  Fly   462 ------FPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFR 520
                  |.::.:..||..::.|..|..:|    :.::.|:|:|.......:...|.:|.::....
  Fly   494 RDDFCFFNNIPFGFPLHENSVFMEPVQKL----IMELAETGLYYHWITTGFSELIDAGEMHFVDL 554

  Fly   521 DRHLEVKS---NDVEYYYLIAGLWFG---GLTLATVCFLLELLIGYAKIK 564
            ..|.|.::   .|::|      :|:|   .:.|:::.:|||.|....|.|
  Fly   555 SPHREFRAMQIQDLQY------VWYGYAFMVVLSSLVWLLENLAYTVKSK 598



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.