DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir92a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster

Alignment Length:517 Identity:100/518 (19%)
Similarity:168/518 (32%) Gaps:157/518 (30%)


  Fly   129 NEGFVNVLVMLPGSDELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGA---- 189
            ||.|.|.:.:.|.             |:|||:.    .||....:....|.||: .|.||.    
  Fly   225 NETFANRVELYPN-------------KLLNLQR----RSLLVGSITYVPYTITN-YVPAGQGDVD 271

  Fly   190 ---PRWFSFRDRQNR-LILTGYMLRMIVDFTNHFNGSVRLMNVLTVN----------DGL----- 235
               |:|      .|| |...|....::..|....|..:|:......|          ||:     
  Fly   272 PIHPQW------PNRSLTFDGAEANVMKTFCQVHNCHLRVEAYGADNWGGIYDNESSDGMLGDIY 330

  Fly   236 ----ELLANRTIDFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWL 296
                |:......:::..:.....:.:.|::.      ::.|...|||:|...:.|:....|:..:
  Fly   331 EQRVEMAIGCIYNWYDGITETSHTIARSSVT------ILGPAPAPLPSWRTNIMPFNNRAWLVLI 389

  Fly   297 IMLIYCSLAL----------------------RILSKGQISISAAFLKVLRLVMYLSGSRDMGTR 339
            ..|:.|...|                      |.|.|..:.|.|.|::        ..|..:...
  Fly   390 STLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEKSMLDIFALFIQ--------QPSAPLSFD 446

  Fly   340 PTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIW--PLIDVDIKTM 402
            ....|.||..||..: ..|.|:|..||.|......|...::|.|...:|...|  |.| :.:.|:
  Fly   447 RFAPRFFLATILCAT-ITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSI-IWVHTV 509

  Fly   403 EKLIPDRTKLLKKIVPTLEADVDTYRRNLN--------TSCIHSGFFDRIDF----ALYQQKFLR 455
            :....:..::|.:   ..|....:|..|::        ...:.||.....|:    ||..:..|.
  Fly   510 QSSDLETEQILAR---NFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLH 571

  Fly   456 FPIFRKFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFR 520
            ..::     ..|.:.:.|......|.|   |..:|...|:|:|...:              |.|.
  Fly   572 DDLY-----FDYTRAVSIRGWILMPEL---NKHIRTCQETGLYFHWE--------------LEFI 614

  Fly   521 DRHLEVKSNDV------------------------EYYYLIAGLWFGGLTLATVCFLLELLI 558
            |::::.|..:|                        ..:.|..|:.|.|..|     :.||||
  Fly   615 DKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCAL-----VAELLI 671



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.