DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir76a

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster

Alignment Length:620 Identity:124/621 (20%)
Similarity:216/621 (35%) Gaps:192/621 (31%)


  Fly    85 EDEHLDRGLYYLANWLW------EYHHLEVLI------------FFNGGSY-------DKLIQIF 124
            |||...:|:.| .:|..      |..|.|..|            |::...|       ::.:.::
  Fly    72 EDEFEGKGIPY-NDWTLRLTVAIERSHCETFIAFQEQIPEFARYFYHASIYSIWRSLRNRFMFVY 135

  Fly   125 SRCFNE-------GFV-----NVLVMLPGSDELYTFMPYQDLKILNLKSIK-------------- 163
            ::.|.:       |::     |:||:.         ..|.:.....:|:.:              
  Fly   136 TKEFEDKKDSYLSGYIFQDQPNILVIT---------SQYLNSSTFEIKTNRFVGPRNFNKNPEPV 191

  Fly   164 EFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTN---HFNGSVRL 225
            |||.|.|  .|..|...|.....|.:.:..:.:.|:..:.:..|...|::|:..   :::   |.
  Fly   192 EFYILQR--FDAKGTKATWETQSAMSSKMRNLKGREVVIGIFDYKPFMLLDYEKPPLYYD---RF 251

  Fly   226 MNVLTVN-DGLEL--------LANRTI--------DFFPFLI----------------------- 250
            ||...|. ||.::        |.|.||        |:....:                       
  Fly   252 MNTTDVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRRNDYGVGGM 316

  Fly   251 ----RPLKSFSMSNILYLENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSK 311
                ...:...|::.|.......:||....|.:|..||||:.|..|:..::.|:..||||.|..:
  Fly   317 YLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTLLLRPFQFVLWMCVMLCLLLESLALGITRR 381

  Fly   312 GQISISAA---FLKVLR------LVMYLSGSRDMGTRPTTRRLFLFVILTTS---GFILTNLYVA 364
            .:.|..||   ::..||      |.::::.|    |...|....|..:|..|   ..|||.:|..
  Fly   382 WEHSSVAAGNSWISSLRFGCISTLKLFVNQS----TNYVTSSYALRTVLVASYMIDIILTTVYSG 442

  Fly   365 QLSSNSAAGLYEKQINTWEDLDKSDSIWP-LIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYR 428
            .|::.......|:..::.:.|.....||. .....|.|:::...|         |.|...::.||
  Fly   443 GLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAWITTIDERSAD---------PVLLGLMEHYR 498

  Fly   429 ---RNLNTSCIHS---GF-FDRIDF------------ALYQQKFLRFPIFRKF-----PHLLYQQ 469
               .||.::..|:   || .:|:.|            ||.:.|.:...|:..|     |.|.   
  Fly   499 VYDANLISAFSHTEQMGFVVERLQFGHLGNTELIENDALKRLKLMVDDIYFAFTVAFVPRLW--- 560

  Fly   470 PLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHL--EVKSN--- 529
                      |:|..:|.|:.....||.     |..:...|.:..:| |.|...:  ..|:|   
  Fly   561 ----------PHLNAYNDFILAWHSSGF-----DKFWEWKIAAEYMN-AHRQNRIVASEKTNLDI 609

  Fly   530 -----DVEYYYLIAGLWFGGLTLATVCFLLELLIG 559
                 .::.:..:..||..|:..:.:.||.||..|
  Fly   610 GPVKLGIDNFIGLILLWCFGMICSLLTFLGELWRG 644



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.