DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67b and Ir60e

Sequence 1:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster

Alignment Length:587 Identity:166/588 (28%)
Similarity:283/588 (48%) Gaps:90/588 (15%)


  Fly    21 VQTVQELNNIYQTELNVFLEFGNGA--DILESAQGTFVPTLWIKNPQNQK---VMKGNFTSCTLT 80
            ||.:|:||...|||||||::|...|  :||.....   |.:.:.:...:.   .::||||..||.
  Fly    28 VQVLQDLNLALQTELNVFIDFECCATSEILHKLDS---PRILLSSNSREARDLRIRGNFTESTLI 89

  Fly    81 ILYLEDEHLDRGL-YYLANWLWEYHHLEVLIFFNGGSYDKLIQIFSRCFNEGFVNVLVMLPGSDE 144
            |:.:.|..|:..: ..|...|.|.|.|.::...|.........:::.||.||||||::|  ....
  Fly    90 IVSVMDSDLNPLVASLLPRLLDELHELHIVFLSNEEPGFPKQDLYTYCFKEGFVNVILM--SGKG 152

  Fly   145 LYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNI---TSGLVIAGAPRWFSFRDRQNRLILTG 206
            ||:::||..::.::|.::.|::..:|...:..|:.:   .|.|    |||.|.:.:.|..|:..|
  Fly   153 LYSYLPYPSIQPISLSNVSEYFDRARIIRNFQGFPVRILRSTL----APRDFEYSNEQGGLVRAG 213

  Fly   207 YMLRMIVDFTNHFNGSVRLMNV---------LTVNDGLELLANRTIDFFPFLIRPLKSFSMSNIL 262
            |:...:.:.|..:|.::..:.:         |.|   .|:|..:.||    ::...|.||: .:.
  Fly   214 YLFTAVKELTYRYNATIESVPIPDLPEYDVYLAV---AEMLHTKKID----IVCYFKDFSL-EVA 270

  Fly   263 YLENCGLI-----VPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSKG-QISISAAFL 321
            |.....:|     .|.:||:.:::|..:|:.:..|...:..::|.::.|.:.::| ::.|....|
  Fly   271 YTAPLSIIREYFMAPHARPISSYLYYSKPFGWTLWAVVISTVLYGTVMLHLAARGARVEIGKCLL 335

  Fly   322 KVLRLVMY-------LSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQI 379
            ..|..::|       ::|.||:.         :..|||..||||||:|:|.|||...:|||:::.
  Fly   336 YSLSHILYNCHQKIRVAGWRDVA---------IHGILTIGGFILTNVYLATLSSILTSGLYDEEY 391

  Fly   380 NTWEDLDKSDSIWP-LIDVDIKTMEK---LIPDRTKLLKKIVPTLEAD-VDTYRRNLNTSCIHSG 439
            ||.|||.::.  :| |.|...::..|   .:|:|   |::...:|.|. :..||..||.|.|:..
  Fly   392 NTLEDLARAP--YPSLHDEYYRSQMKAKTFLPER---LRRNSLSLNATLLKAYRDGLNQSYIYIL 451

  Fly   440 FFDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFG-----------RPYLQLFNWFVRKIF 493
            :.||::..|.||..|:.|.|.           .|..|.|           .|||.:.:.|:|::.
  Fly   452 YEDRLELILMQQYLLKTPRFN-----------MIRQAVGFTLESYCVSNSLPYLAMTSEFMRRLQ 505

  Fly   494 ESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLTLATVCFLLELLI 558
            |.||.:|||.|.:|..|..|:..| .||.....|:.|::||:....||..||..:.:.|..||:.
  Fly   506 EHGISIKMKADTFRELIHQGIYTL-MRDDEPPAKAFDLDYYFFAFVLWTVGLISSLLVFFAELVS 569

  Fly   559 GY 560
            |:
  Fly   570 GH 571



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131158575
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.